ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/tags/owl-1.9.2/reconstruct/sample.cm
Revision: 1365
Committed: Mon Mar 28 16:51:55 2011 UTC (9 years, 2 months ago) by hstehr
File size: 3520 byte(s)
Log Message:
tagging owl-1.9.2 to match CMView-1.9.2-released-as-1.1rc5
Line User Rev File contents
1 duarte 978 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVEVVE
3     #PDB: 1bxy
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: Cb
8     #CUTOFF: 8.0
9     1 2 1.000
10     1 3 1.000
11     1 38 1.000
12     1 39 1.000
13     2 3 1.000
14     2 38 1.000
15     2 39 1.000
16     2 58 1.000
17     2 60 1.000
18     3 4 1.000
19     3 5 1.000
20     3 36 1.000
21     3 37 1.000
22     3 38 1.000
23     3 39 1.000
24     3 59 1.000
25     3 60 1.000
26     4 5 1.000
27     4 6 1.000
28     4 36 1.000
29     4 37 1.000
30     4 38 1.000
31     4 39 1.000
32     4 43 1.000
33     4 44 1.000
34     4 47 1.000
35     4 56 1.000
36     4 57 1.000
37     4 58 1.000
38     4 59 1.000
39     5 6 1.000
40     5 7 1.000
41     5 34 1.000
42     5 35 1.000
43     5 36 1.000
44     5 37 1.000
45     5 56 1.000
46     5 57 1.000
47     5 58 1.000
48     5 59 1.000
49     6 7 1.000
50     6 8 1.000
51     6 26 1.000
52     6 28 1.000
53     6 34 1.000
54     6 35 1.000
55     6 36 1.000
56     6 37 1.000
57     6 47 1.000
58     6 54 1.000
59     6 55 1.000
60     6 56 1.000
61     7 8 1.000
62     7 9 1.000
63     7 32 1.000
64     7 33 1.000
65     7 34 1.000
66     7 35 1.000
67     7 54 1.000
68     7 55 1.000
69     7 56 1.000
70     7 57 1.000
71     8 9 1.000
72     8 10 1.000
73     8 12 1.000
74     8 23 1.000
75     8 28 1.000
76     8 29 1.000
77     8 30 1.000
78     8 31 1.000
79     8 32 1.000
80     8 33 1.000
81     8 34 1.000
82     8 53 1.000
83     8 54 1.000
84     8 55 1.000
85     9 10 1.000
86     9 31 1.000
87     9 32 1.000
88     9 53 1.000
89     9 54 1.000
90     9 55 1.000
91     10 11 1.000
92     10 12 1.000
93     10 31 1.000
94     10 52 1.000
95     10 53 1.000
96     10 54 1.000
97     11 12 1.000
98     11 13 1.000
99     11 31 1.000
100     11 53 1.000
101     12 13 1.000
102     12 14 1.000
103     12 15 1.000
104     12 19 1.000
105     12 20 1.000
106     12 23 1.000
107     12 50 1.000
108     12 53 1.000
109     13 14 1.000
110     13 15 1.000
111     14 15 1.000
112     14 16 1.000
113     14 20 1.000
114     15 16 1.000
115     15 19 1.000
116     15 20 1.000
117     15 53 1.000
118     16 17 1.000
119     16 18 1.000
120     16 19 1.000
121     16 20 1.000
122     17 18 1.000
123     17 19 1.000
124     17 20 1.000
125     17 21 1.000
126     18 19 1.000
127     18 20 1.000
128     18 21 1.000
129     18 22 1.000
130     18 49 1.000
131     19 20 1.000
132     19 21 1.000
133     19 22 1.000
134     19 23 1.000
135     19 49 1.000
136     19 50 1.000
137     19 53 1.000
138     20 21 1.000
139     20 22 1.000
140     20 23 1.000
141     20 24 1.000
142     21 22 1.000
143     21 23 1.000
144     21 24 1.000
145     21 25 1.000
146     22 23 1.000
147     22 24 1.000
148     22 25 1.000
149     22 26 1.000
150     22 45 1.000
151     22 46 1.000
152     22 47 1.000
153     22 49 1.000
154     22 50 1.000
155     23 24 1.000
156     23 25 1.000
157     23 26 1.000
158     23 27 1.000
159     23 28 1.000
160     23 29 1.000
161     23 50 1.000
162     23 53 1.000
163     24 25 1.000
164     24 26 1.000
165     24 27 1.000
166     25 26 1.000
167     25 27 1.000
168     25 46 1.000
169     26 27 1.000
170     26 28 1.000
171     26 35 1.000
172     26 37 1.000
173     26 43 1.000
174     26 46 1.000
175     26 47 1.000
176     26 50 1.000
177     26 54 1.000
178     27 28 1.000
179     27 29 1.000
180     27 33 1.000
181     27 35 1.000
182     28 29 1.000
183     28 30 1.000
184     28 33 1.000
185     28 35 1.000
186     28 50 1.000
187     28 54 1.000
188     29 30 1.000
189     29 33 1.000
190     30 31 1.000
191     30 32 1.000
192     30 33 1.000
193     31 32 1.000
194     31 33 1.000
195     32 33 1.000
196     32 34 1.000
197     33 34 1.000
198     33 35 1.000
199     34 35 1.000
200     34 36 1.000
201     35 36 1.000
202     35 37 1.000
203     36 37 1.000
204     36 59 1.000
205     37 38 1.000
206     37 39 1.000
207     37 43 1.000
208     38 39 1.000
209     38 40 1.000
210     38 43 1.000
211     39 40 1.000
212     39 43 1.000
213     39 44 1.000
214     39 58 1.000
215     40 41 1.000
216     40 42 1.000
217     40 43 1.000
218     40 44 1.000
219     41 42 1.000
220     41 43 1.000
221     41 44 1.000
222     41 45 1.000
223     42 43 1.000
224     42 44 1.000
225     42 45 1.000
226     42 46 1.000
227     43 44 1.000
228     43 45 1.000
229     43 46 1.000
230     43 47 1.000
231     44 45 1.000
232     44 46 1.000
233     44 47 1.000
234     44 48 1.000
235     45 46 1.000
236     45 47 1.000
237     45 48 1.000
238     45 49 1.000
239     46 47 1.000
240     46 48 1.000
241     46 49 1.000
242     46 50 1.000
243     47 48 1.000
244     47 49 1.000
245     47 50 1.000
246     47 51 1.000
247     47 54 1.000
248     47 56 1.000
249     48 49 1.000
250     48 50 1.000
251     48 51 1.000
252     49 50 1.000
253     49 51 1.000
254     50 51 1.000
255     50 52 1.000
256     50 53 1.000
257     50 54 1.000
258     51 52 1.000
259     51 53 1.000
260     51 54 1.000
261     52 53 1.000
262     52 54 1.000
263     53 54 1.000
264     54 55 1.000
265     54 56 1.000
266     55 56 1.000
267     55 57 1.000
268     56 57 1.000
269     56 58 1.000
270     57 58 1.000
271     57 59 1.000
272     58 59 1.000
273     59 60 1.000