ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/modelit/server/results/MLH1_WT_1-340/MLH1_WT_1-340.pdb-blast.out
Revision: 1299
Committed: Tue Jan 11 17:38:33 2011 UTC (8 years, 8 months ago) by hstehr
File size: 23427 byte(s)
Log Message:
adding Model-It server files to repository
Line File contents
1 <?xml version="1.0"?>
2 <!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
3 <BlastOutput>
4 <BlastOutput_program>blastp</BlastOutput_program>
5 <BlastOutput_version>blastp 2.2.18 [Mar-02-2008]</BlastOutput_version>
6 <BlastOutput_reference>~Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, ~Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), ~&quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search~programs&quot;, Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
7 <BlastOutput_db>/project/StruPPi/CASP8/blast_dbs/seqs_pdbase_20080903.fix.reps.fa</BlastOutput_db>
8 <BlastOutput_query-ID>lcl|1_0</BlastOutput_query-ID>
9 <BlastOutput_query-def>MLH1_HUMAN P40692 DNA mismatch repair protein Mlh1 OS=Homo sapiens GN=MLH1 PE=1 SV=1</BlastOutput_query-def>
10 <BlastOutput_query-len>340</BlastOutput_query-len>
11 <BlastOutput_param>
12 <Parameters>
13 <Parameters_matrix>BLOSUM62</Parameters_matrix>
14 <Parameters_expect>10</Parameters_expect>
15 <Parameters_gap-open>11</Parameters_gap-open>
16 <Parameters_gap-extend>1</Parameters_gap-extend>
17 <Parameters_filter>F</Parameters_filter>
18 </Parameters>
19 </BlastOutput_param>
20 <BlastOutput_iterations>
21 <Iteration>
22 <Iteration_iter-num>1</Iteration_iter-num>
23 <Iteration_query-ID>lcl|1_0</Iteration_query-ID>
24 <Iteration_query-def>MLH1_HUMAN P40692 DNA mismatch repair protein Mlh1 OS=Homo sapiens GN=MLH1 PE=1 SV=1</Iteration_query-def>
25 <Iteration_query-len>340</Iteration_query-len>
26 <Iteration_hits>
27 <Hit>
28 <Hit_num>1</Hit_num>
29 <Hit_id>gnl|BL_ORD_ID|399</Hit_id>
30 <Hit_def>pdb|1B63|A protein</Hit_def>
31 <Hit_accession>399</Hit_accession>
32 <Hit_len>333</Hit_len>
33 <Hit_hsps>
34 <Hsp>
35 <Hsp_num>1</Hsp_num>
36 <Hsp_bit-score>209.92</Hsp_bit-score>
37 <Hsp_score>533</Hsp_score>
38 <Hsp_evalue>3.90868e-55</Hsp_evalue>
39 <Hsp_query-from>8</Hsp_query-from>
40 <Hsp_query-to>334</Hsp_query-to>
41 <Hsp_hit-from>5</Hsp_hit-from>
42 <Hsp_hit-to>332</Hsp_hit-to>
43 <Hsp_query-frame>1</Hsp_query-frame>
44 <Hsp_hit-frame>1</Hsp_hit-frame>
45 <Hsp_identity>119</Hsp_identity>
46 <Hsp_positive>191</Hsp_positive>
47 <Hsp_gaps>7</Hsp_gaps>
48 <Hsp_align-len>331</Hsp_align-len>
49 <Hsp_qseq>IRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGK-LKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVD-NIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKC--IFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKL</Hsp_qseq>
50 <Hsp_hseq>IQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALARHATSKIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQA-YAEGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLR--GWVADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQGVLSVL</Hsp_hseq>
51 <Hsp_midline>I+ L + N+IAAGEV++RPA+ +KE++EN LDA +T I + ++ GG KLI+I+DNG GI+K++L + R TSK+ S +DL +I + GFRGEALASIS V+ +T+T++TA+ + A++A Y++G+ + KP A GT + V DLFYN RRK L+ E+ I E++ R ++ ++ ++ G+ V R +P + + +I G A + + I + L + G++++ N++ I ++N R++ + AI L + P L LEI P VDVNVHP KHEV F + + + Q + S L</Hsp_midline>
52 </Hsp>
53 </Hit_hsps>
54 </Hit>
55 <Hit>
56 <Hit_num>2</Hit_num>
57 <Hit_id>gnl|BL_ORD_ID|2567</Hit_id>
58 <Hit_def>pdb|1H7S|A B protein</Hit_def>
59 <Hit_accession>2567</Hit_accession>
60 <Hit_len>365</Hit_len>
61 <Hit_hsps>
62 <Hsp>
63 <Hsp_num>1</Hsp_num>
64 <Hsp_bit-score>168.318</Hsp_bit-score>
65 <Hsp_score>425</Hsp_score>
66 <Hsp_evalue>1.47809e-42</Hsp_evalue>
67 <Hsp_query-from>5</Hsp_query-from>
68 <Hsp_query-to>336</Hsp_query-to>
69 <Hsp_hit-from>12</Hsp_hit-from>
70 <Hsp_hit-to>361</Hsp_hit-to>
71 <Hsp_query-frame>1</Hsp_query-frame>
72 <Hsp_hit-frame>1</Hsp_hit-frame>
73 <Hsp_identity>115</Hsp_identity>
74 <Hsp_positive>196</Hsp_positive>
75 <Hsp_gaps>36</Hsp_gaps>
76 <Hsp_align-len>359</Hsp_align-len>
77 <Hsp_qseq>AGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYS-DGKL--KAP-PKPCAGNQGTQITVEDLFYNIATRRKAL-KNPSEEYGKILEVVGRYSVHNAGISFSVKK---QGETVADVRTLPNASTVDNIRSIFGNAVSRELIEI--------GCEDKTLA--------FKMNGYISNANYSVKKCIF---LLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLG</Hsp_qseq>
78 <Hsp_hseq>AKAIKPIDRKSVHQICSGQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFADLTQVETFGFRGEALSSLCALSDVTISTCHASAKVGTRLXFDHNGKIIQKTPYPRP----RGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKXVQVLHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENIGSVFGQKQLQSLIPFVQLPPSDSVCEEYGLSCSDALHNLFYISGFISQCTHGVGRSSTDRQFFFINRRPCDPAKVCRLVNEVYHXY-NRHQYPFVVLNISVDSECVDINVTPDKRQI-LLQEEKLLLAV---LKTSLIG</Hsp_hseq>
79 <Hsp_midline>A I+ +D V++I +G+V+ + A+KE++EN LDA +T+I + +K+ G+ LI++ DNG G+ +E+ + + + TSK+Q F DL + T+GFRGEAL+S+ ++ VTI+T A K R + +GK+ K P P+P +GT ++V+ LF + R K +N +EY K ++V+ Y + +AGI S QG+ V T + S +NI S+FG + LI CE+ L+ F ++G+IS + V + FIN R + + + + VY Y ++ +PF+ L++ + + VD+NV P K ++ L EE +L V +++ L+G</Hsp_midline>
80 </Hsp>
81 </Hit_hsps>
82 </Hit>
83 <Hit>
84 <Hit_num>3</Hit_num>
85 <Hit_id>gnl|BL_ORD_ID|8226</Hit_id>
86 <Hit_def>pdb|1VA6|A B protein</Hit_def>
87 <Hit_accession>8226</Hit_accession>
88 <Hit_len>518</Hit_len>
89 <Hit_hsps>
90 <Hsp>
91 <Hsp_num>1</Hsp_num>
92 <Hsp_bit-score>32.3426</Hsp_bit-score>
93 <Hsp_score>72</Hsp_score>
94 <Hsp_evalue>0.127648</Hsp_evalue>
95 <Hsp_query-from>150</Hsp_query-from>
96 <Hsp_query-to>176</Hsp_query-to>
97 <Hsp_hit-from>251</Hsp_hit-from>
98 <Hsp_hit-to>277</Hsp_hit-to>
99 <Hsp_query-frame>1</Hsp_query-frame>
100 <Hsp_hit-frame>1</Hsp_hit-frame>
101 <Hsp_identity>14</Hsp_identity>
102 <Hsp_positive>19</Hsp_positive>
103 <Hsp_align-len>27</Hsp_align-len>
104 <Hsp_qseq>ITVEDLFYNIATRRKALKNPSEEYGKI</Hsp_qseq>
105 <Hsp_hseq>ITFNDLYEYVAGLKQAIKTPSEEYAKI</Hsp_hseq>
106 <Hsp_midline>IT DL+ +A ++A+K PSEEY KI</Hsp_midline>
107 </Hsp>
108 </Hit_hsps>
109 </Hit>
110 <Hit>
111 <Hit_num>4</Hit_num>
112 <Hit_id>gnl|BL_ORD_ID|16682</Hit_id>
113 <Hit_def>pdb|2P1G|A B protein</Hit_def>
114 <Hit_accession>16682</Hit_accession>
115 <Hit_len>249</Hit_len>
116 <Hit_hsps>
117 <Hsp>
118 <Hsp_num>1</Hsp_num>
119 <Hsp_bit-score>31.5722</Hsp_bit-score>
120 <Hsp_score>70</Hsp_score>
121 <Hsp_evalue>0.225124</Hsp_evalue>
122 <Hsp_query-from>241</Hsp_query-from>
123 <Hsp_query-to>322</Hsp_query-to>
124 <Hsp_hit-from>81</Hsp_hit-from>
125 <Hsp_hit-to>164</Hsp_hit-to>
126 <Hsp_query-frame>1</Hsp_query-frame>
127 <Hsp_hit-frame>1</Hsp_hit-frame>
128 <Hsp_identity>29</Hsp_identity>
129 <Hsp_positive>44</Hsp_positive>
130 <Hsp_gaps>24</Hsp_gaps>
131 <Hsp_align-len>95</Hsp_align-len>
132 <Hsp_qseq>KMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLP---------KNTHPFLYLSLEISPQNVDVNVHPTK----HEVHFLHEESI</Hsp_qseq>
133 <Hsp_hseq>KIDGYTSRLHYISD------WINNAVRQGL-----LEDVTAAYSPFKQKLSLSYMSTHPELYKSLKNSPENVAQMAKYEKALSGKEVHYLPKDKL</Hsp_hseq>
134 <Hsp_midline>K++GY S +Y +IN+ + + +E V AAY P +THP LY SL+ SP+NV K EVH+L ++ +</Hsp_midline>
135 </Hsp>
136 </Hit_hsps>
137 </Hit>
138 <Hit>
139 <Hit_num>5</Hit_num>
140 <Hit_id>gnl|BL_ORD_ID|75</Hit_id>
141 <Hit_def>pdb|1A6T|B D protein</Hit_def>
142 <Hit_accession>75</Hit_accession>
143 <Hit_len>217</Hit_len>
144 <Hit_hsps>
145 <Hsp>
146 <Hsp_num>1</Hsp_num>
147 <Hsp_bit-score>28.8758</Hsp_bit-score>
148 <Hsp_score>63</Hsp_score>
149 <Hsp_evalue>1.22468</Hsp_evalue>
150 <Hsp_query-from>171</Hsp_query-from>
151 <Hsp_query-to>204</Hsp_query-to>
152 <Hsp_hit-from>39</Hsp_hit-from>
153 <Hsp_hit-to>72</Hsp_hit-to>
154 <Hsp_query-frame>1</Hsp_query-frame>
155 <Hsp_hit-frame>1</Hsp_hit-frame>
156 <Hsp_identity>13</Hsp_identity>
157 <Hsp_positive>20</Hsp_positive>
158 <Hsp_align-len>34</Hsp_align-len>
159 <Hsp_qseq>EEYGKILEVVGRYSVHNAGISFSVKKQGETVADV</Hsp_qseq>
160 <Hsp_hseq>QSHGKSLEWIGRVDPDNGGTSFNQKFKGKAILTV</Hsp_hseq>
161 <Hsp_midline>+ +GK LE +GR N G SF+ K +G+ + V</Hsp_midline>
162 </Hsp>
163 </Hit_hsps>
164 </Hit>
165 <Hit>
166 <Hit_num>6</Hit_num>
167 <Hit_id>gnl|BL_ORD_ID|2477</Hit_id>
168 <Hit_def>pdb|1GZ7|A B C D protein</Hit_def>
169 <Hit_accession>2477</Hit_accession>
170 <Hit_len>534</Hit_len>
171 <Hit_hsps>
172 <Hsp>
173 <Hsp_num>1</Hsp_num>
174 <Hsp_bit-score>28.8758</Hsp_bit-score>
175 <Hsp_score>63</Hsp_score>
176 <Hsp_evalue>1.29833</Hsp_evalue>
177 <Hsp_query-from>50</Hsp_query-from>
178 <Hsp_query-to>150</Hsp_query-to>
179 <Hsp_hit-from>158</Hsp_hit-from>
180 <Hsp_hit-to>258</Hsp_hit-to>
181 <Hsp_query-frame>1</Hsp_query-frame>
182 <Hsp_hit-frame>1</Hsp_hit-frame>
183 <Hsp_identity>25</Hsp_identity>
184 <Hsp_positive>42</Hsp_positive>
185 <Hsp_gaps>6</Hsp_gaps>
186 <Hsp_align-len>104</Hsp_align-len>
187 <Hsp_qseq>IVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSFE-DLASISTYGFRGEALASISHVAHVTITT--KTADGKCAYRASYSDGKLKAPPKPCAGNQGTQI</Hsp_qseq>
188 <Hsp_hseq>VASWGFLAGPDIQNEGSGNAGLHDQRLAMQWVADNIAGFGGDPSKVTIYG---ESAGSMSTFVHLVWNDGDNTYNGKPLFRAAIMQSGCMVPSDPVDGTYGTEI</Hsp_hseq>
189 <Hsp_midline>+ G L IQ+ G+G + ++ + F D + ++ YG E+ S+S H+ T +GK +RA+ P P G GT+I</Hsp_midline>
190 </Hsp>
191 </Hit_hsps>
192 </Hit>
193 <Hit>
194 <Hit_num>7</Hit_num>
195 <Hit_id>gnl|BL_ORD_ID|2260</Hit_id>
196 <Hit_def>pdb|1GDJ|A protein</Hit_def>
197 <Hit_accession>2260</Hit_accession>
198 <Hit_len>153</Hit_len>
199 <Hit_hsps>
200 <Hsp>
201 <Hsp_num>1</Hsp_num>
202 <Hsp_bit-score>28.8758</Hsp_bit-score>
203 <Hsp_score>63</Hsp_score>
204 <Hsp_evalue>1.42314</Hsp_evalue>
205 <Hsp_query-from>266</Hsp_query-from>
206 <Hsp_query-to>305</Hsp_query-to>
207 <Hsp_hit-from>3</Hsp_hit-from>
208 <Hsp_hit-to>43</Hsp_hit-to>
209 <Hsp_query-frame>1</Hsp_query-frame>
210 <Hsp_hit-frame>1</Hsp_hit-frame>
211 <Hsp_identity>17</Hsp_identity>
212 <Hsp_positive>24</Hsp_positive>
213 <Hsp_gaps>1</Hsp_gaps>
214 <Hsp_align-len>41</Hsp_align-len>
215 <Hsp_qseq>LVES-TSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDV</Hsp_qseq>
216 <Hsp_hseq>LTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKDL</Hsp_hseq>
217 <Hsp_midline>L ES +L K+ + A +PK+TH F L LEI+P D+</Hsp_midline>
218 </Hsp>
219 </Hit_hsps>
220 </Hit>
221 <Hit>
222 <Hit_num>8</Hit_num>
223 <Hit_id>gnl|BL_ORD_ID|2323</Hit_id>
224 <Hit_def>pdb|1GKZ|A protein</Hit_def>
225 <Hit_accession>2323</Hit_accession>
226 <Hit_len>388</Hit_len>
227 <Hit_hsps>
228 <Hsp>
229 <Hsp_num>1</Hsp_num>
230 <Hsp_bit-score>28.4906</Hsp_bit-score>
231 <Hsp_score>62</Hsp_score>
232 <Hsp_evalue>2.05441</Hsp_evalue>
233 <Hsp_query-from>30</Hsp_query-from>
234 <Hsp_query-to>84</Hsp_query-to>
235 <Hsp_hit-from>249</Hsp_hit-from>
236 <Hsp_hit-to>307</Hsp_hit-to>
237 <Hsp_query-frame>1</Hsp_query-frame>
238 <Hsp_hit-frame>1</Hsp_hit-frame>
239 <Hsp_identity>19</Hsp_identity>
240 <Hsp_positive>31</Hsp_positive>
241 <Hsp_gaps>4</Hsp_gaps>
242 <Hsp_align-len>59</Hsp_align-len>
243 <Hsp_qseq>NAIKEMIENCLDAKSTSIQVIVKEGGLK---LIQIQDNGTGIRKEDLDIVCE-RFTTSK</Hsp_qseq>
244 <Hsp_hseq>NAMRATMESHLDTPYNVPDVVITIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAE</Hsp_hseq>
245 <Hsp_midline>NA++ +E+ LD V++ +I+I D G GI +DLD V + FTT++</Hsp_midline>
246 </Hsp>
247 </Hit_hsps>
248 </Hit>
249 <Hit>
250 <Hit_num>9</Hit_num>
251 <Hit_id>gnl|BL_ORD_ID|10088</Hit_id>
252 <Hit_def>pdb|1YSR|A B C protein</Hit_def>
253 <Hit_accession>10088</Hit_accession>
254 <Hit_len>150</Hit_len>
255 <Hit_hsps>
256 <Hsp>
257 <Hsp_num>1</Hsp_num>
258 <Hsp_bit-score>28.1054</Hsp_bit-score>
259 <Hsp_score>61</Hsp_score>
260 <Hsp_evalue>2.34782</Hsp_evalue>
261 <Hsp_query-from>42</Hsp_query-from>
262 <Hsp_query-to>81</Hsp_query-to>
263 <Hsp_hit-from>50</Hsp_hit-from>
264 <Hsp_hit-to>102</Hsp_hit-to>
265 <Hsp_query-frame>1</Hsp_query-frame>
266 <Hsp_hit-frame>1</Hsp_hit-frame>
267 <Hsp_identity>17</Hsp_identity>
268 <Hsp_positive>25</Hsp_positive>
269 <Hsp_gaps>13</Hsp_gaps>
270 <Hsp_align-len>53</Hsp_align-len>
271 <Hsp_qseq>AKSTSIQVIVKEGGLKLIQ-------------IQDNGTGIRKEDLDIVCERFT</Hsp_qseq>
272 <Hsp_hseq>AVDNAIANAVKHGGATLVQLSAVSSRAGVEIAIDDNGSGVPEGERQVVFERFS</Hsp_hseq>
273 <Hsp_midline>A +I VK GG L+Q I DNG+G+ + + +V ERF+</Hsp_midline>
274 </Hsp>
275 </Hit_hsps>
276 </Hit>
277 <Hit>
278 <Hit_num>10</Hit_num>
279 <Hit_id>gnl|BL_ORD_ID|5906</Hit_id>
280 <Hit_def>pdb|1Q0P|A protein</Hit_def>
281 <Hit_accession>5906</Hit_accession>
282 <Hit_len>223</Hit_len>
283 <Hit_hsps>
284 <Hsp>
285 <Hsp_num>1</Hsp_num>
286 <Hsp_bit-score>28.1054</Hsp_bit-score>
287 <Hsp_score>61</Hsp_score>
288 <Hsp_evalue>2.40733</Hsp_evalue>
289 <Hsp_query-from>247</Hsp_query-from>
290 <Hsp_query-to>290</Hsp_query-to>
291 <Hsp_hit-from>77</Hsp_hit-from>
292 <Hsp_hit-to>121</Hsp_hit-to>
293 <Hsp_query-frame>1</Hsp_query-frame>
294 <Hsp_hit-frame>1</Hsp_hit-frame>
295 <Hsp_identity>13</Hsp_identity>
296 <Hsp_positive>26</Hsp_positive>
297 <Hsp_gaps>1</Hsp_gaps>
298 <Hsp_align-len>45</Hsp_align-len>
299 <Hsp_qseq>SNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAY-LPKNTHP</Hsp_qseq>
300 <Hsp_hseq>SNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPP</Hsp_hseq>
301 <Hsp_midline>SNA++ K+ + + +H+L T+ +KA++ VY+ P + P</Hsp_midline>
302 </Hsp>
303 </Hit_hsps>
304 </Hit>
305 <Hit>
306 <Hit_num>11</Hit_num>
307 <Hit_id>gnl|BL_ORD_ID|11588</Hit_id>
308 <Hit_def>pdb|2C2A|A protein</Hit_def>
309 <Hit_accession>11588</Hit_accession>
310 <Hit_len>258</Hit_len>
311 <Hit_hsps>
312 <Hsp>
313 <Hsp_num>1</Hsp_num>
314 <Hsp_bit-score>28.1054</Hsp_bit-score>
315 <Hsp_score>61</Hsp_score>
316 <Hsp_evalue>2.55212</Hsp_evalue>
317 <Hsp_query-from>41</Hsp_query-from>
318 <Hsp_query-to>80</Hsp_query-to>
319 <Hsp_hit-from>157</Hsp_hit-from>
320 <Hsp_hit-to>197</Hsp_hit-to>
321 <Hsp_query-frame>1</Hsp_query-frame>
322 <Hsp_hit-frame>1</Hsp_hit-frame>
323 <Hsp_identity>17</Hsp_identity>
324 <Hsp_positive>26</Hsp_positive>
325 <Hsp_gaps>3</Hsp_gaps>
326 <Hsp_align-len>42</Hsp_align-len>
327 <Hsp_qseq>DAKSTSIQVIV--KEGGLKLIQIQDNGTGIRKEDLDIVCERF</Hsp_qseq>
328 <Hsp_hseq>DAPDKYVKVILDEKDGGV-LIIVEDNGIGIPDHAKDRIFEQF</Hsp_hseq>
329 <Hsp_midline>DA ++VI+ K+GG+ LI ++DNG GI D + E+F</Hsp_midline>
330 </Hsp>
331 </Hit_hsps>
332 </Hit>
333 <Hit>
334 <Hit_num>12</Hit_num>
335 <Hit_id>gnl|BL_ORD_ID|16403</Hit_id>
336 <Hit_def>pdb|2OK5|A protein</Hit_def>
337 <Hit_accession>16403</Hit_accession>
338 <Hit_len>752</Hit_len>
339 <Hit_hsps>
340 <Hsp>
341 <Hsp_num>1</Hsp_num>
342 <Hsp_bit-score>27.7202</Hsp_bit-score>
343 <Hsp_score>60</Hsp_score>
344 <Hsp_evalue>3.30548</Hsp_evalue>
345 <Hsp_query-from>247</Hsp_query-from>
346 <Hsp_query-to>290</Hsp_query-to>
347 <Hsp_hit-from>315</Hsp_hit-from>
348 <Hsp_hit-to>359</Hsp_hit-to>
349 <Hsp_query-frame>1</Hsp_query-frame>
350 <Hsp_hit-frame>1</Hsp_hit-frame>
351 <Hsp_identity>13</Hsp_identity>
352 <Hsp_positive>26</Hsp_positive>
353 <Hsp_gaps>1</Hsp_gaps>
354 <Hsp_align-len>45</Hsp_align-len>
355 <Hsp_qseq>SNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAY-LPKNTHP</Hsp_qseq>
356 <Hsp_hseq>SNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPP</Hsp_hseq>
357 <Hsp_midline>SNA++ K+ + + +H+L T+ +KA++ VY+ P + P</Hsp_midline>
358 </Hsp>
359 </Hit_hsps>
360 </Hit>
361 <Hit>
362 <Hit_num>13</Hit_num>
363 <Hit_id>gnl|BL_ORD_ID|6624</Hit_id>
364 <Hit_def>pdb|1RRK|A protein</Hit_def>
365 <Hit_accession>6624</Hit_accession>
366 <Hit_len>497</Hit_len>
367 <Hit_hsps>
368 <Hsp>
369 <Hsp_num>1</Hsp_num>
370 <Hsp_bit-score>27.335</Hsp_bit-score>
371 <Hsp_score>59</Hsp_score>
372 <Hsp_evalue>3.93851</Hsp_evalue>
373 <Hsp_query-from>247</Hsp_query-from>
374 <Hsp_query-to>290</Hsp_query-to>
375 <Hsp_hit-from>63</Hsp_hit-from>
376 <Hsp_hit-to>107</Hsp_hit-to>
377 <Hsp_query-frame>1</Hsp_query-frame>
378 <Hsp_hit-frame>1</Hsp_hit-frame>
379 <Hsp_identity>13</Hsp_identity>
380 <Hsp_positive>26</Hsp_positive>
381 <Hsp_gaps>1</Hsp_gaps>
382 <Hsp_align-len>45</Hsp_align-len>
383 <Hsp_qseq>SNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAY-LPKNTHP</Hsp_qseq>
384 <Hsp_hseq>SNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPP</Hsp_hseq>
385 <Hsp_midline>SNA++ K+ + + +H+L T+ +KA++ VY+ P + P</Hsp_midline>
386 </Hsp>
387 </Hit_hsps>
388 </Hit>
389 <Hit>
390 <Hit_num>14</Hit_num>
391 <Hit_id>gnl|BL_ORD_ID|16296</Hit_id>
392 <Hit_def>pdb|2OCD|A B C D protein</Hit_def>
393 <Hit_accession>16296</Hit_accession>
394 <Hit_len>337</Hit_len>
395 <Hit_hsps>
396 <Hsp>
397 <Hsp_num>1</Hsp_num>
398 <Hsp_bit-score>26.9498</Hsp_bit-score>
399 <Hsp_score>58</Hsp_score>
400 <Hsp_evalue>4.89267</Hsp_evalue>
401 <Hsp_query-from>249</Hsp_query-from>
402 <Hsp_query-to>310</Hsp_query-to>
403 <Hsp_hit-from>140</Hsp_hit-from>
404 <Hsp_hit-to>200</Hsp_hit-to>
405 <Hsp_query-frame>1</Hsp_query-frame>
406 <Hsp_hit-frame>1</Hsp_hit-frame>
407 <Hsp_identity>20</Hsp_identity>
408 <Hsp_positive>33</Hsp_positive>
409 <Hsp_gaps>5</Hsp_gaps>
410 <Hsp_align-len>64</Hsp_align-len>
411 <Hsp_qseq>ANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLY--LSLEISPQNVDVNVHPT</Hsp_qseq>
412 <Hsp_hseq>ANYPINEVT--LFFNNRLXRGNRSRKSHADGFSAFSSPNLPPLLEAGINIELS-TNVKVDEKPS</Hsp_hseq>
413 <Hsp_midline>ANY + + LF N+RL RK+ ++A+ N P L +++E+S NV V+ P+</Hsp_midline>
414 </Hsp>
415 </Hit_hsps>
416 </Hit>
417 <Hit>
418 <Hit_num>15</Hit_num>
419 <Hit_id>gnl|BL_ORD_ID|13709</Hit_id>
420 <Hit_def>pdb|2FOK|A B protein</Hit_def>
421 <Hit_accession>13709</Hit_accession>
422 <Hit_len>579</Hit_len>
423 <Hit_hsps>
424 <Hsp>
425 <Hsp_num>1</Hsp_num>
426 <Hsp_bit-score>26.1794</Hsp_bit-score>
427 <Hsp_score>56</Hsp_score>
428 <Hsp_evalue>8.13933</Hsp_evalue>
429 <Hsp_query-from>47</Hsp_query-from>
430 <Hsp_query-to>78</Hsp_query-to>
431 <Hsp_hit-from>314</Hsp_hit-from>
432 <Hsp_hit-to>342</Hsp_hit-to>
433 <Hsp_query-frame>1</Hsp_query-frame>
434 <Hsp_hit-frame>1</Hsp_hit-frame>
435 <Hsp_identity>13</Hsp_identity>
436 <Hsp_positive>21</Hsp_positive>
437 <Hsp_gaps>3</Hsp_gaps>
438 <Hsp_align-len>32</Hsp_align-len>
439 <Hsp_qseq>IQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCE</Hsp_qseq>
440 <Hsp_hseq>LEILIKAGSLKIEQIQDN---LKKLGFDEVIE</Hsp_hseq>
441 <Hsp_midline>+++++K G LK+ QIQDN ++K D V E</Hsp_midline>
442 </Hsp>
443 </Hit_hsps>
444 </Hit>
445 <Hit>
446 <Hit_num>16</Hit_num>
447 <Hit_id>gnl|BL_ORD_ID|12215</Hit_id>
448 <Hit_def>pdb|2D7P|A protein</Hit_def>
449 <Hit_accession>12215</Hit_accession>
450 <Hit_len>112</Hit_len>
451 <Hit_hsps>
452 <Hsp>
453 <Hsp_num>1</Hsp_num>
454 <Hsp_bit-score>26.1794</Hsp_bit-score>
455 <Hsp_score>56</Hsp_score>
456 <Hsp_evalue>9.69806</Hsp_evalue>
457 <Hsp_query-from>25</Hsp_query-from>
458 <Hsp_query-to>68</Hsp_query-to>
459 <Hsp_hit-from>47</Hsp_hit-from>
460 <Hsp_hit-to>90</Hsp_hit-to>
461 <Hsp_query-frame>1</Hsp_query-frame>
462 <Hsp_hit-frame>1</Hsp_hit-frame>
463 <Hsp_identity>13</Hsp_identity>
464 <Hsp_positive>24</Hsp_positive>
465 <Hsp_align-len>44</Hsp_align-len>
466 <Hsp_qseq>IQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGI</Hsp_qseq>
467 <Hsp_hseq>VHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHI</Hsp_hseq>
468 <Hsp_midline>+ P+ A++E + LD+ +I+ I E G+ I ++ NG I</Hsp_midline>
469 </Hsp>
470 </Hit_hsps>
471 </Hit>
472 </Iteration_hits>
473 <Iteration_stat>
474 <Statistics>
475 <Statistics_db-num>20430</Statistics_db-num>
476 <Statistics_db-len>4636376</Statistics_db-len>
477 <Statistics_hsp-len>92</Statistics_hsp-len>
478 <Statistics_eff-space>6.8369e+08</Statistics_eff-space>
479 <Statistics_kappa>0.041</Statistics_kappa>
480 <Statistics_lambda>0.267</Statistics_lambda>
481 <Statistics_entropy>0.14</Statistics_entropy>
482 </Statistics>
483 </Iteration_stat>
484 </Iteration>
485 </BlastOutput_iterations>
486 </BlastOutput>