ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/modelit/server/results/MLH1_WT_1-340/MLH1_WT_1-340.pdb-psiblast.classic.out
Revision: 1299
Committed: Tue Jan 11 17:38:33 2011 UTC (8 years, 8 months ago) by hstehr
File size: 35420 byte(s)
Log Message:
adding Model-It server files to repository
Line File contents
1 BLASTP 2.2.18 [Mar-02-2008]
2
3
4 Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
5 Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
6 "Gapped BLAST and PSI-BLAST: a new generation of protein database search
7 programs", Nucleic Acids Res. 25:3389-3402.
8
9
10 Reference for composition-based statistics:
11 Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
12 Sergei Shavirin, John L. Spouge, Yuri I. Wolf,
13 Eugene V. Koonin, and Stephen F. Altschul (2001),
14 "Improving the accuracy of PSI-BLAST protein database searches with
15 composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005.
16
17 Query= MLH1_HUMAN P40692 DNA mismatch repair protein Mlh1 OS=Homo
18 sapiens GN=MLH1 PE=1 SV=1
19 (340 letters)
20
21 Database: seqs_pdbase_20080903.fix.reps.fa
22 20,430 sequences; 4,636,376 total letters
23
24 Searching..................................................done
25
26
27
28 Score E
29 Sequences producing significant alignments: (bits) Value
30
31 pdb|1B63|A protein 420 e-118
32 pdb|1H7S|A B protein 353 2e-98
33 pdb|1S16|A B protein 188 2e-48
34 pdb|1EI1|A B protein 169 5e-43
35 pdb|1AJ6|A protein 145 1e-35
36 pdb|1KIJ|A B protein 128 2e-30
37 pdb|1S14|A B protein 119 9e-28
38 pdb|2Q2E|B protein 59 1e-09
39 pdb|1MU5|A protein 55 2e-08
40 pdb|2ZBK|B D F H protein 54 3e-08
41 pdb|2O1U|A B protein 45 2e-05
42 pdb|2O1W|A B C D E protein 45 2e-05
43 pdb|2GQP|A B protein 44 3e-05
44 pdb|1QY5|A protein 44 4e-05
45 pdb|1YC1|A protein 42 2e-04
46 pdb|1UYL|A protein 40 6e-04
47 pdb|2CG9|A B protein 38 0.002
48 pdb|2IOQ|A B protein 38 0.002
49 pdb|1Y4S|A B protein 38 0.002
50 pdb|2AKP|A B protein 37 0.003
51 pdb|2IWX|A protein 37 0.004
52 pdb|2IOR|A protein 37 0.004
53 pdb|1ZXM|A B protein 36 0.009
54 pdb|1PVG|A B protein 32 0.11
55 pdb|1GKZ|A protein 31 0.24
56 pdb|1TH8|A protein 31 0.30
57 pdb|1YSR|A B C protein 30 0.53
58 pdb|2FUE|A protein 29 0.91
59 pdb|2C2A|A protein 29 1.3
60 pdb|2B9S|A protein 28 2.4
61 pdb|1FRB|A protein 28 2.6
62 pdb|2E5W|A B C D protein 27 3.2
63 pdb|2E3N|A protein 27 3.4
64 pdb|1KQF|A protein 27 6.1
65 pdb|1I58|A B protein 27 7.0
66 pdb|1U3D|A protein 26 7.7
67 pdb|1B3Q|A B protein 26 8.0
68 pdb|2CH4|A B protein 26 8.0
69
70 >pdb|1B63|A protein
71 Length = 333
72
73 Score = 420 bits (1080), Expect = e-118, Method: Composition-based stats.
74 Identities = 116/329 (35%), Positives = 179/329 (54%), Gaps = 1/329 (0%)
75
76 Query: 8 IRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTG 67
77 I+ L + N+IAAGEV++RPA+ +KE++EN LDA +T I + ++ GG KLI+I+DNG G
78 Sbjct: 5 IQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCG 64
79
80 Query: 68 IRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYR 127
81 I+K++L + R TSK+ S +DL +I + GFRGEALASIS V+ +T+T++TA+ + A++
82 Sbjct: 65 IKKDELALALARHATSKIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQ 124
83
84 Query: 128 ASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHN 187
85 A + KP A GT + V DLFYN RRK L+ E+ I E++ R ++
86 Sbjct: 125 AYAEGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRTEKTEFNHIDEIIRRIALAR 184
87
88 Query: 188 AGISFSVKKQGETVADVRTLPNASTVD-NIRSIFGNAVSRELIEIGCEDKTLAFKMNGYI 246
89 ++ ++ G+ V R +P + + +I G A + + I + L +
90 Sbjct: 185 FDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVAD 244
91
92 Query: 247 SNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVN 306
93 N I ++N R++ + AI L + P L LEI P VDVN
94 Sbjct: 245 PNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVN 304
95
96 Query: 307 VHPTKHEVHFLHEESILERVQQHIESKLL 335
97 VHP KHEV F + + + Q + S L
98 Sbjct: 305 VHPAKHEVRFHQSRLVHDFIYQGVLSVLQ 333
99
100
101 >pdb|1H7S|A B protein
102 Length = 365
103
104 Score = 353 bits (907), Expect = 2e-98, Method: Composition-based stats.
105 Identities = 102/352 (28%), Positives = 180/352 (51%), Gaps = 24/352 (6%)
106
107 Query: 2 SFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQI 61
108 + A I+ +D V++I +G+V+ + A+KE++EN LDA +T+I + +K+ G+ LI++
109 Sbjct: 9 TEPAKAIKPIDRKSVHQICSGQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEV 68
110
111 Query: 62 QDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTAD 121
112 DNG G+ +E+ + + + TSK+Q F DL + T+GFRGEAL+S+ ++ VTI+T A
113 Sbjct: 69 SDNGCGVEEENFEGLTLKHHTSKIQEFADLTQVETFGFRGEALSSLCALSDVTISTCHAS 128
114
115 Query: 122 GKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRK-ALKNPSEEYGKILEVV 180
116 K R + P +GT ++V+ LF + R K +N +EY K ++V+
117 Sbjct: 129 AKVGTRLXFDHNGKIIQKTPYPRPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKXVQVL 188
118
119 Query: 181 GRYSVHNAGISFSVKK---QGETVADVRTLPNASTVDNIRSIFGNAVSRELIEI------ 231
120 Y + +AGI S QG+ V T + S +NI S+FG + LI
121 Sbjct: 189 HAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENIGSVFGQKQLQSLIPFVQLPPS 248
122
123 Query: 232 ----------GCEDKTLAFKMNGYISNANYSVKK---CIFLLFINHRLVESTSLRKAIET 278
124 + F ++G+IS + V + FIN R + + + +
125 Sbjct: 249 DSVCEEYGLSCSDALHNLFYISGFISQCTHGVGRSSTDRQFFFINRRPCDPAKVCRLVNE 308
126
127 Query: 279 VYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHI 330
128 VY Y ++ +PF+ L++ + + VD+NV P K ++ E+ +L ++ +
129 Sbjct: 309 VYHXY-NRHQYPFVVLNISVDSECVDINVTPDKRQILLQEEKLLLAVLKTSL 359
130
131
132 >pdb|1S16|A B protein
133 Length = 390
134
135 Score = 188 bits (477), Expect = 2e-48, Method: Composition-based stats.
136 Identities = 39/303 (12%), Positives = 90/303 (29%), Gaps = 31/303 (10%)
137
138 Query: 2 SFVAGVIRRLDETVVNRIAAGEVI--QRPANAIKEMIENCLD----AKSTSIQVIVKEGG 55
139 ++ A I L R G RP + +E+I+N +D + + VI+
140 Sbjct: 4 TYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHAD- 62
141
142 Query: 56 LKLIQIQDNGTGIRKEDLD---------IVCERFTTSKLQSFEDLASISTYGFRGEALAS 106
143 + +++ D+G G+ + I+C K F + + G G ++
144 Sbjct: 63 -QSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGK---FSNKNYQFSGGLHGVGISV 118
145
146 Query: 107 ISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKAL 166
147 ++ ++ DG+ Y ++ +G+ + F+
148 Sbjct: 119 VNALSKRVEVNVRRDGQV-YNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPD---ETFF 174
149
150 Query: 167 KNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSR 226
151 +P ++ V+ +V G+ + K + + ++ G
152 Sbjct: 175 DSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQDGLNDYLAEAVNGLPTLP 234
153
154 Query: 227 ELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRL-----VESTSLRKAIETVYA 281
155 E IG + + ++N LR+ +
156 Sbjct: 235 EKPFIGNFAGDTEAVDWALLWLPEGGE--LLTESYVNLIPTMQGGTHVNGLRQGLLDAMR 292
157
158 Query: 282 AYL 284
159 +
160 Sbjct: 293 EFC 295
161
162
163 >pdb|1EI1|A B protein
164 Length = 391
165
166 Score = 169 bits (430), Expect = 5e-43, Method: Composition-based stats.
167 Identities = 41/299 (13%), Positives = 86/299 (28%), Gaps = 35/299 (11%)
168
169 Query: 8 IRRLDETVVNRIAAGEVI------QRPANAIKEMIENCLD---AKSTSIQVIVKEGGLKL 58
170 I+ L R G I + + E+++N +D A ++IV
171 Sbjct: 9 IKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCK-EIIVTIHADNS 67
172
173 Query: 59 IQIQDNGTGIRKEDLD---------IVCERFTTSKLQSFEDLASISTYGFRGEALASISH 109
174 + +QD+G GI I+ K F+D + + G G ++ ++
175 Sbjct: 68 VSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGK---FDDNSYKVSGGLHGVGVSVVNA 124
176
177 Query: 110 VAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNP 169
178 ++ +GK + Y G +AP + T V +
179 Sbjct: 125 LSQKLELVIQREGKIHRQI-YEHGVPQAPLAVTGETEKTGTMVRF----WPSLETFTNVT 179
180
181 Query: 170 SEEYGKILEVVGRYSVHNAGISFSVKK--QGETVADVRTLPNASTVDNIRSIFGNAVSRE 227
182 EY + + + S ++G+S ++ G+ + +
183 Sbjct: 180 EFEYEILAKRLRELSFLDSGVSIRLRDKRDGKED-HFHYEGGIKAFVEYLNKNKTPIHPN 238
184
185 Query: 228 LIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKA-IETVYAAYLP 285
186 + E + ++ + + F N+ A L
187 Sbjct: 239 IFYFSTEKDGIGVEV----ALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLN 293
188
189
190 >pdb|1AJ6|A protein
191 Length = 219
192
193 Score = 145 bits (367), Expect = 1e-35, Method: Composition-based stats.
194 Identities = 38/226 (16%), Positives = 76/226 (33%), Gaps = 27/226 (11%)
195
196 Query: 2 SFVAGVIRRLDETVVNRIAAGEVI------QRPANAIKEMIENCLD---AKSTSIQVIVK 52
197 S+ + I+ L R G I + + E+++N +D A ++IV
198 Sbjct: 3 SYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCK-EIIVT 61
199
200 Query: 53 EGGLKLIQIQDNGTGIRKEDLD---------IVCERFTTSKLQSFEDLASISTYGFRGEA 103
201 + +QD+G GI I+ K F+D + + G G
202 Sbjct: 62 IHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGK---FDDNSYKVSGGLHGVG 118
203
204 Query: 104 LASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRR 163
205 ++ ++ ++ +GK + Y G +AP + T V +
206 Sbjct: 119 VSVVNALSQKLELVIQHEGKIHRQI-YEHGVPQAPLAVTGETEKTGTMVRF----WPSLE 173
207
208 Query: 164 KALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPN 209
209 EY + + + S N+G+S ++ + + D
210 Sbjct: 174 TFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEG 219
211
212
213 >pdb|1KIJ|A B protein
214 Length = 390
215
216 Score = 128 bits (321), Expect = 2e-30, Method: Composition-based stats.
217 Identities = 52/307 (16%), Positives = 98/307 (31%), Gaps = 37/307 (12%)
218
219 Query: 1 MSFVAGVIRRLDETVVNRIAAGEVI-----QRPANAIKEMIENCLD---AK-STSIQVIV 51
220 MS+ A IR L R I + + KE+++N +D A +T I V +
221 Sbjct: 1 MSYDASAIRVLKGLEGVRHRPAMYIGGTGVEGYHHLFKEILDNAVDEALAGYATEILVRL 60
222
223 Query: 52 KEGGLKLIQIQDNGTGIRKEDLD---IVCERFTTSKLQSFEDLA---SISTYGFRGEALA 105
224 E G + ++DNG GI + + + L S + G G +
225 Sbjct: 61 NEDG--SLTVEDNGRGIPVDLMPEEGKPAVEVIYNTLHSGGKFEQGAYKVSGGLHGVGAS 118
226
227 Query: 106 SISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKA 165
228 ++ ++ T+ +GK R ++S G++ P + + F +
229 Sbjct: 119 VVNALSEWTVVEVFREGKHH-RIAFSRGEVTEPLRVVGEAPRGKTGTRVTFKPDP---EI 174
230
231 Query: 166 LKNPSEEYGKILEVVGRYSVHNAGIS--FSVKKQGETVADVRTLPNASTVDNIRS----I 219
232 N + KI + + AG+ F ++ G+ + AS + +
233 Sbjct: 175 FGNLRFDPSKIRARLREVAYLVAGLKLVFQDRQHGKEEVFLDKGGVASFAKALAEGEDLL 234
234
235 Query: 220 FGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLR-KAIET 278
236 + E + GY L + N A ++
237 Sbjct: 235 YEKPFLIRGTHGEVEVEVGFLHTQGY---------NAEILTYANMIPTRDGGTHLTAFKS 285
238
239 Query: 279 VYAAYLP 285
240 Y+ L
241 Sbjct: 286 AYSRALN 292
242
243
244 >pdb|1S14|A B protein
245 Length = 194
246
247 Score = 119 bits (298), Expect = 9e-28, Method: Composition-based stats.
248 Identities = 26/217 (11%), Positives = 66/217 (30%), Gaps = 35/217 (16%)
249
250 Query: 2 SFVAGVIRRLDETVVNRIAAGEVI--QRPANAIKEMIENCLD----AKSTSIQVIVKEGG 55
251 ++ A I L R G RP + +E+I+N +D + + VI+
252 Sbjct: 4 TYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHAD- 62
253
254 Query: 56 LKLIQIQDNGTGIRKEDLD---IVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAH 112
255 + +++ D+G G+ + + ++ ++ ++
256 Sbjct: 63 -QSLEVIDDGRGMPVDIHPEEGVPAVELILC--------------------ISVVNALSK 101
257
258 Query: 113 VTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEE 172
259 DG+ Y ++ +G+ + F+ +P
260 Sbjct: 102 RVEVNVRRDGQV-YNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPD---ETFFDSPRFS 157
261
262 Query: 173 YGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPN 209
263 ++ V+ +V G+ + K + +
264 Sbjct: 158 VSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQD 194
265
266
267 >pdb|2Q2E|B protein
268 Length = 621
269
270 Score = 59.1 bits (142), Expect = 1e-09, Method: Composition-based stats.
271 Identities = 37/204 (18%), Positives = 69/204 (33%), Gaps = 36/204 (17%)
272
273 Query: 27 RPANAIKEMIENCLDAKSTS-----IQVIVKEGGLKLIQIQ--DNGTGIRKEDLDIVCER 79
274 +KE ++N LDA + I V V+ G + + DNG GI +E + V +
275 Sbjct: 37 SLITTVKEAVDNALDACEEAGILPDILVQVERTGPDYVTVIIEDNGPGIVREQIPKVFAK 96
276
277 Query: 80 -FTTSKLQSFEDLASISTYGFRGEALASISHVAHVT------ITTKTADGKCAYRASY-- 130
278 S+ + + G +G +++ A +T I +KT+ A+
279 Sbjct: 97 LLYGSRFHAL-----KQSRGQQGIGISAAVLYAQMTAGRHTKILSKTSPTAPAHYYELMI 151
280
281 Query: 131 -----SDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSV 185
282 L + GTQI +E + RR++ I E + ++
283 Sbjct: 152 NTSTNEPDILVDEVRDWFRPHGTQIELEMRAAYVKGRRQS----------IYEYLKATAI 201
284
285 Query: 186 HNAGISFSVKKQGETVADVRTLPN 209
286 N ++ +
287 Sbjct: 202 VNPHARITLIDPDGNEEVFERATD 225
288
289
290 >pdb|1MU5|A protein
291 Length = 471
292
293 Score = 54.8 bits (131), Expect = 2e-08, Method: Composition-based stats.
294 Identities = 33/195 (16%), Positives = 63/195 (32%), Gaps = 45/195 (23%)
295
296 Query: 28 PANAIKEMIENCLDAKST---------SIQVIVKEGGLK--LIQIQDNGTGIRKEDLDIV 76
297 ++E+IEN LDA T I + + + + + + DNG GI +++
298 Sbjct: 33 LYQTVRELIENSLDA--TDVHGILPNIKITIDLIDDARQIYKVNVVDNGIGIPPQEVPNA 90
299
300 Query: 77 CER-FTTSKLQSFEDLASISTYGFRGEALASISHVAHV------TITTKTADGKCAY--- 126
301 R +SK + T G G + + + + I T + K Y
302 Sbjct: 91 FGRVLYSSKY------VNRQTRGMYGLGVKAAVLYSQMHQDKPIEIETSPVNSKRIYTFK 144
303
304 Query: 127 -RASYSDGKLK----APPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVG 181
305 + + + + G GT + + I + + +I E +
306 Sbjct: 145 LKIDINKNEPIIVERGSVENTRGFHGTSVAIS-----IPG------DWPKAKSRIYEYIK 193
307
308 Query: 182 RYSVHNAGISFSVKK 196
309 R + F K
310 Sbjct: 194 RTYIITPYAEFIFKD 208
311
312
313 >pdb|2ZBK|B D F H protein
314 Length = 530
315
316 Score = 54.4 bits (130), Expect = 3e-08, Method: Composition-based stats.
317 Identities = 33/195 (16%), Positives = 63/195 (32%), Gaps = 45/195 (23%)
318
319 Query: 28 PANAIKEMIENCLDAKST---------SIQVIVKEGGLK--LIQIQDNGTGIRKEDLDIV 76
320 ++E+IEN LDA T I + + + + + + DNG GI +++
321 Sbjct: 32 LYQTVRELIENSLDA--TDVHGILPNIKITIDLIDDARQIYKVNVVDNGIGIPPQEVPNA 89
322
323 Query: 77 CER-FTTSKLQSFEDLASISTYGFRGEALASISHVAHV------TITTKTADGKCAY--- 126
324 R +SK + T G G + + + + I T + K Y
325 Sbjct: 90 FGRVLYSSKY------VNRQTRGMYGLGVKAAVLYSQMHQDKPIEIETSPVNSKRIYTFK 143
326
327 Query: 127 -RASYSDGKLK----APPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVG 181
328 + + + + G GT + + I + + +I E +
329 Sbjct: 144 LKIDINKNEPIIVERGSVENTRGFHGTSVAIS-----IPG------DWPKAKSRIYEYIK 192
330
331 Query: 182 RYSVHNAGISFSVKK 196
332 R + F K
333 Sbjct: 193 RTYIITPYAEFIFKD 207
334
335
336 >pdb|2O1U|A B protein
337 Length = 666
338
339 Score = 45.2 bits (106), Expect = 2e-05, Method: Composition-based stats.
340 Identities = 53/312 (16%), Positives = 96/312 (30%), Gaps = 66/312 (21%)
341
342 Query: 37 ENCLDAKSTSIQVIVK-EGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSF------- 88
343 EN L A + + V +K + L+ + D G G+ +E+L S F
344 Sbjct: 72 ENAL-AGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEA 130
345
346 Query: 89 -EDLASISTY-GFRGEALASISHVA-HVTITTKTADGKCA-YRASYSDGKLKAPPKPCAG 144
347 ED S S G G S VA V +T+K + + + ++ + A P+
348 Sbjct: 131 QEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTL 190
349
350 Query: 145 NQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS-VHNAGI------------- 190
351 +GT IT+ K + E I +V +YS N I
352 Sbjct: 191 GRGTTITLV---------LKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGGGGKT 241
353
354 Query: 191 --SFSVKKQGETVADVRTLP-NASTVDNIRSIFGNAVSRELIEIGCEDKTL-AFKMNGYI 246
355 + + + + + F + I + FK ++
356 Sbjct: 242 VWDWELMNDIKPIWQRPSKEVEDDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFV 301
357
358 Query: 247 S--------NANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSL-- 296
359 + S K L++ + + +PK YL+
360 Sbjct: 302 PTSAPRGLFDEYGSKKSDYIKLYVRRVFITDD---------FHDMMPK------YLNFVK 346
361
362 Query: 297 -EISPQNVDVNV 307
363 + ++ +NV
364 Sbjct: 347 GVVDSDDLPLNV 358
365
366
367 >pdb|2O1W|A B C D E protein
368 Length = 506
369
370 Score = 45.2 bits (106), Expect = 2e-05, Method: Composition-based stats.
371 Identities = 53/312 (16%), Positives = 96/312 (30%), Gaps = 66/312 (21%)
372
373 Query: 37 ENCLDAKSTSIQVIVK-EGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSF------- 88
374 EN L A + + V +K + L+ + D G G+ +E+L S F
375 Sbjct: 72 ENAL-AGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEA 130
376
377 Query: 89 -EDLASISTY-GFRGEALASISHVA-HVTITTKTADGKCA-YRASYSDGKLKAPPKPCAG 144
378 ED S S G G S VA V +T+K + + + ++ + A P+
379 Sbjct: 131 QEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTL 190
380
381 Query: 145 NQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS-VHNAGI------------- 190
382 +GT IT+ K + E I +V +YS N I
383 Sbjct: 191 GRGTTITLV---------LKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGGGGKT 241
384
385 Query: 191 --SFSVKKQGETVADVRTLP-NASTVDNIRSIFGNAVSRELIEIGCEDKTL-AFKMNGYI 246
386 + + + + + F + I + FK ++
387 Sbjct: 242 VWDWELMNDIKPIWQRPSKEVEDDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFV 301
388
389 Query: 247 S--------NANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSL-- 296
390 + S K L++ + + +PK YL+
391 Sbjct: 302 PTSAPRGLFDEYGSKKSDYIKLYVRRVFITDD---------FHDMMPK------YLNFVK 346
392
393 Query: 297 -EISPQNVDVNV 307
394 + ++ +NV
395 Sbjct: 347 GVVDSDDLPLNV 358
396
397
398 >pdb|2GQP|A B protein
399 Length = 236
400
401 Score = 44.4 bits (104), Expect = 3e-05, Method: Composition-based stats.
402 Identities = 38/160 (23%), Positives = 61/160 (38%), Gaps = 22/160 (13%)
403
404 Query: 37 ENCLDAKSTSIQVIVK-EGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSF------- 88
405 EN L A + + V +K + L+ + D G G+ +E+L S F
406 Sbjct: 59 ENAL-AGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEA 117
407
408 Query: 89 -EDLASISTY-GFRGEALASISHVA-HVTITTKTADGKCA-YRASYSDGKLKAPPKPCAG 144
409 ED S S G G S VA V +T+K + + + ++ + A P+
410 Sbjct: 118 QEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTL 177
411
412 Query: 145 NQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS 184
413 +GT IT+ K + E I +V +YS
414 Sbjct: 178 GRGTTITLV---------LKEEASDYLELDTIKNLVKKYS 208
415
416
417 >pdb|1QY5|A protein
418 Length = 269
419
420 Score = 44.0 bits (103), Expect = 4e-05, Method: Composition-based stats.
421 Identities = 38/160 (23%), Positives = 61/160 (38%), Gaps = 22/160 (13%)
422
423 Query: 37 ENCLDAKSTSIQVIVK-EGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSF------- 88
424 EN L A + + V +K + L+ + D G G+ +E+L S F
425 Sbjct: 55 ENAL-AGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEA 113
426
427 Query: 89 -EDLASISTY-GFRGEALASISHVA-HVTITTKTADGKCA-YRASYSDGKLKAPPKPCAG 144
428 ED S S G G S VA V +T+K + + + ++ + A P+
429 Sbjct: 114 QEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTL 173
430
431 Query: 145 NQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS 184
432 +GT IT+ K + E I +V +YS
433 Sbjct: 174 GRGTTITLV---------LKEEASDYLELDTIKNLVKKYS 204
434
435
436 >pdb|1YC1|A protein
437 Length = 264
438
439 Score = 41.7 bits (97), Expect = 2e-04, Method: Composition-based stats.
440 Identities = 40/179 (22%), Positives = 59/179 (32%), Gaps = 38/179 (21%)
441
442 Query: 32 IKEMIENCLDAKSTSIQVIVK------EGGLKL------------IQIQDNGTGIRKEDL 73
443 ++E+I N DA I+ + G +L + I D G G+ K DL
444 Sbjct: 73 LRELISNSSDA-LDKIRYETLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADL 131
445
446 Query: 74 -------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAH-VTITTKTADGKCA 125
447 + LQ+ D++ I G G S VA VT+ TK D +
448 Sbjct: 132 INNLGTIAKSGTKAFMEALQAGADISMI---GQFGVGFYSAYLVAEKVTVITKHNDDEQ- 187
449
450 Query: 126 YRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS 184
451 Y S G G V K + E +I E+V ++S
452 Sbjct: 188 YAWESSAGGSFTVRTDTGEPMGRGTKVILH-------LKEDQTEYLEERRIKEIVKKHS 239
453
454
455 >pdb|1UYL|A protein
456 Length = 236
457
458 Score = 40.2 bits (93), Expect = 6e-04, Method: Composition-based stats.
459 Identities = 40/179 (22%), Positives = 59/179 (32%), Gaps = 38/179 (21%)
460
461 Query: 32 IKEMIENCLDAKSTSIQVIVK------EGGLKL------------IQIQDNGTGIRKEDL 73
462 ++E+I N DA I+ + G +L + I D G G+ K DL
463 Sbjct: 45 LRELISNSSDA-LDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADL 103
464
465 Query: 74 -------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAH-VTITTKTADGKCA 125
466 + LQ+ D++ I G G S VA VT+ TK D +
467 Sbjct: 104 INNLGTIAKSGTKAFMEALQAGADISMI---GQFGVGFYSAYLVAEKVTVITKHNDDEQ- 159
468
469 Query: 126 YRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS 184
470 Y S G G V K + E +I E+V ++S
471 Sbjct: 160 YAWESSAGGSFTVRTDTGEPMGRGTKVILH-------LKEDQTEYLEERRIKEIVKKHS 211
472
473
474 >pdb|2CG9|A B protein
475 Length = 677
476
477 Score = 38.3 bits (88), Expect = 0.002, Method: Composition-based stats.
478 Identities = 31/139 (22%), Positives = 53/139 (38%), Gaps = 24/139 (17%)
479
480 Query: 57 KLIQIQDNGTGIRKEDL-------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISH 109
481 K+++I+D+G G+ K +L + L + D++ I G G S+
482 Sbjct: 73 KVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMI---GQFGVGFYSLFL 129
483
484 Query: 110 VA-HVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKN 168
485 VA V + +K+ D + S + G G + R LK+
486 Sbjct: 130 VADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTIL----------RLFLKD 179
487
488 Query: 169 PSEEY---GKILEVVGRYS 184
489 EY +I EV+ R+S
490 Sbjct: 180 DQLEYLEEKRIKEVIKRHS 198
491
492
493 >pdb|2IOQ|A B protein
494 Length = 624
495
496 Score = 38.3 bits (88), Expect = 0.002, Method: Composition-based stats.
497 Identities = 29/147 (19%), Positives = 53/147 (36%), Gaps = 28/147 (19%)
498
499 Query: 32 IKEMIENCLDA------------------KSTSIQVIVKEGGLKLIQIQDNGTGIRKED- 72
500 ++E+I N DA ++V + + + I DNG G+ +++
501 Sbjct: 32 LRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKD-KRTLTISDNGVGMTRDEV 90
502
503 Query: 73 ---LDIVCERFTTSKLQSFEDLASIST--YGFRGEALASISHVA-HVTITTKTADG--KC 124
504 L + + T S L+S + + G G S VA VT+ T+ A +
505 Sbjct: 91 IDHLGTIAKSGTKSFLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPEN 150
506
507 Query: 125 AYRASYSDGKLKAPPKPCAGNQGTQIT 151
508 + ++GT+IT
509 Sbjct: 151 GVFWESAGEGEYTVADITKEDRGTEIT 177
510
511
512 >pdb|1Y4S|A B protein
513 Length = 559
514
515 Score = 38.3 bits (88), Expect = 0.002, Method: Composition-based stats.
516 Identities = 29/147 (19%), Positives = 53/147 (36%), Gaps = 28/147 (19%)
517
518 Query: 32 IKEMIENCLDA------------------KSTSIQVIVKEGGLKLIQIQDNGTGIRKED- 72
519 ++E+I N DA ++V + + + I DNG G+ +++
520 Sbjct: 32 LRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKD-KRTLTISDNGVGMTRDEV 90
521
522 Query: 73 ---LDIVCERFTTSKLQSFEDLASIST--YGFRGEALASISHVA-HVTITTKTADG--KC 124
523 L + + T S L+S + + G G S VA VT+ T+ A +
524 Sbjct: 91 IDHLGTIAKSGTKSFLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPEN 150
525
526 Query: 125 AYRASYSDGKLKAPPKPCAGNQGTQIT 151
527 + ++GT+IT
528 Sbjct: 151 GVFWESAGEGEYTVADITKEDRGTEIT 177
529
530
531 >pdb|2AKP|A B protein
532 Length = 186
533
534 Score = 37.5 bits (86), Expect = 0.003, Method: Composition-based stats.
535 Identities = 31/139 (22%), Positives = 53/139 (38%), Gaps = 24/139 (17%)
536
537 Query: 57 KLIQIQDNGTGIRKEDL-------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISH 109
538 K+++I+D+G G+ K +L + L + D++ I G G S+
539 Sbjct: 49 KVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMI---GQFGVGFYSLFL 105
540
541 Query: 110 VA-HVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKN 168
542 VA V + +K+ D + S + G G + R LK+
543 Sbjct: 106 VADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTIL----------RLFLKD 155
544
545 Query: 169 PSEEY---GKILEVVGRYS 184
546 EY +I EV+ R+S
547 Sbjct: 156 DQLEYLEEKRIKEVIKRHS 174
548
549
550 >pdb|2IWX|A protein
551 Length = 214
552
553 Score = 37.5 bits (86), Expect = 0.004, Method: Composition-based stats.
554 Identities = 31/139 (22%), Positives = 53/139 (38%), Gaps = 24/139 (17%)
555
556 Query: 57 KLIQIQDNGTGIRKEDL-------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISH 109
557 K+++I+D+G G+ K +L + L + D++ I G G S+
558 Sbjct: 73 KVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMI---GQFGVGFYSLFL 129
559
560 Query: 110 VA-HVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKN 168
561 VA V + +K+ D + S + G G + R LK+
562 Sbjct: 130 VADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTIL----------RLFLKD 179
563
564 Query: 169 PSEEY---GKILEVVGRYS 184
565 EY +I EV+ R+S
566 Sbjct: 180 DQLEYLEEKRIKEVIKRHS 198
567
568
569 >pdb|2IOR|A protein
570 Length = 235
571
572 Score = 37.1 bits (85), Expect = 0.004, Method: Composition-based stats.
573 Identities = 29/147 (19%), Positives = 53/147 (36%), Gaps = 28/147 (19%)
574
575 Query: 32 IKEMIENCLDA------------------KSTSIQVIVKEGGLKLIQIQDNGTGIRKED- 72
576 ++E+I N DA ++V + + + I DNG G+ +++
577 Sbjct: 52 LRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKD-KRTLTISDNGVGMTRDEV 110
578
579 Query: 73 ---LDIVCERFTTSKLQSFEDLASIST--YGFRGEALASISHVA-HVTITTKTADG--KC 124
580 L + + T S L+S + + G G S VA VT+ T+ A +
581 Sbjct: 111 IDHLGTIAKSGTKSFLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPEN 170
582
583 Query: 125 AYRASYSDGKLKAPPKPCAGNQGTQIT 151
584 + ++GT+IT
585 Sbjct: 171 GVFWESAGEGEYTVADITKEDRGTEIT 197
586
587
588 >pdb|1ZXM|A B protein
589 Length = 400
590
591 Score = 36.3 bits (83), Expect = 0.009, Method: Composition-based stats.
592 Identities = 31/188 (16%), Positives = 61/188 (32%), Gaps = 19/188 (10%)
593
594 Query: 41 DAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLD--------IVCERFTTSKLQSFEDLA 92
595 D K + I+V + LI I +NG GI + ++ + TS +++D
596 Sbjct: 71 DPKMSCIRVTIDPE-NNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTS--SNYDDDE 127
597
598 Query: 93 SISTYGFRGEALASISHVA-HVTITTKTADGKCAYR---ASYSDGKLKAPPKPCAGNQGT 148
599 T G G + + T+ T + + K ++ + KP G T
600 Sbjct: 128 KKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYT 187
601
602 Query: 149 QITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLP 208
603 IT F ++ K + ++ + + + V R+
604 Sbjct: 188 CIT----FQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYV 243
605
606 Query: 209 NASTVDNI 216
607 + D +
608 Sbjct: 244 DMYLKDKL 251
609
610
611 >pdb|1PVG|A B protein
612 Length = 418
613
614 Score = 32.5 bits (73), Expect = 0.11, Method: Composition-based stats.
615 Identities = 17/91 (18%), Positives = 32/91 (35%), Gaps = 16/91 (17%)
616
617 Query: 24 VIQRPANAIKEMIENCLDAK-----STSIQVIVKEGGLKLIQIQDNGTGIRKEDL----- 73
618 ++ E++ N D K I V + I+++++G GI E
619 Sbjct: 61 IVPGLFKIFDEILVNAADNKVRDPSXKRIDVNIHAEEHT-IEVKNDGKGIPIEIHNKENI 119
620
621 Query: 74 ---DIVCERFTTSKLQSFEDLASISTYGFRG 101
622 + + TS +++D T G G
623 Sbjct: 120 YIPEXIFGHLLTS--SNYDDDEKKVTGGRNG 148
624
625
626 >pdb|1GKZ|A protein
627 Length = 388
628
629 Score = 31.3 bits (70), Expect = 0.24, Method: Composition-based stats.
630 Identities = 17/68 (25%), Positives = 30/68 (44%), Gaps = 11/68 (16%)
631
632 Query: 34 EMIENCLDA----------KSTSIQVIVKEGGLKLI-QIQDNGTGIRKEDLDIVCERFTT 82
633 E+++N + A + + + + LI +I D G GI +DLD V + T
634 Sbjct: 245 ELLKNAMRATMESHLDTPYNVPDVVITIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFT 304
635
636 Query: 83 SKLQSFED 90
637 + S +D
638 Sbjct: 305 TAEASTQD 312
639
640
641 >pdb|1TH8|A protein
642 Length = 145
643
644 Score = 30.9 bits (69), Expect = 0.30, Method: Composition-based stats.
645 Identities = 14/62 (22%), Positives = 28/62 (45%), Gaps = 10/62 (16%)
646
647 Query: 30 NAIKEMIENCLDAKSTS-------IQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTT 82
648 + E + N + + I VI+++G + L ++D G GI D++ + T
649 Sbjct: 42 TVVSEAVTNAIIHGYNNDPNGIVSISVIIEDGVVHL-TVRDEGVGIP--DIEEARQPLFT 98
650
651 Query: 83 SK 84
652 +K
653 Sbjct: 99 TK 100
654
655
656 >pdb|1YSR|A B C protein
657 Length = 150
658
659 Score = 30.2 bits (67), Expect = 0.53, Method: Composition-based stats.
660 Identities = 20/86 (23%), Positives = 38/86 (44%), Gaps = 17/86 (19%)
661
662 Query: 36 IENCL-----DAKSTSIQVI--VKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSF 88
663 ++N + +T +Q+ G++ I I DNG+G+ + + +V ER F
664 Sbjct: 51 VDNAIANAVKHGGATLVQLSAVSSRAGVE-IAIDDNGSGVPEGERQVVFER--------F 101
665
666 Query: 89 EDLASISTYGFRGEALASISHVAHVT 114
667 ++ S G G LA ++ A +
668 Sbjct: 102 SRGSTASHSG-SGLGLALVAQQAQLH 126
669
670
671 >pdb|2FUE|A protein
672 Length = 262
673
674 Score = 29.4 bits (65), Expect = 0.91, Method: Composition-based stats.
675 Identities = 22/136 (16%), Positives = 36/136 (26%), Gaps = 5/136 (3%)
676
677 Query: 125 AYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS 184
678 + +G L P + +I +L R K ++ E+ R
679 Sbjct: 126 GTFIEFRNGXLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSR-- 183
680
681 Query: 185 VHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNG 244
682 ISF V +G + + D I FGN S + +
683 Sbjct: 184 --GGXISFDVFPEGWDKRYCLDSLDQDSFDTI-HFFGNETSPGGNDFEIFADPRTVGHSV 240
684
685 Query: 245 YISNANYSVKKCIFLL 260
686 + IF
687 Sbjct: 241 VSPQDTVQRCREIFFP 256
688
689
690 >pdb|2C2A|A protein
691 Length = 258
692
693 Score = 29.0 bits (64), Expect = 1.3, Method: Composition-based stats.
694 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 8/51 (15%)
695
696 Query: 26 QRPANAIKEMIENCL-----DAKSTSIQVIV--KEGGLKLIQIQDNGTGIR 69
697 R + ++ N + DA ++VI+ K+GG+ LI ++DNG GI
698 Sbjct: 137 TRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGV-LIIVEDNGIGIP 186
699
700
701 >pdb|2B9S|A protein
702 Length = 432
703
704 Score = 28.2 bits (62), Expect = 2.4, Method: Composition-based stats.
705 Identities = 10/71 (14%), Positives = 19/71 (26%), Gaps = 5/71 (7%)
706
707 Query: 119 TADGKCAYRASYSDG--KLKAPPKPCAGNQGTQITVEDLFYNIAT-RRKALKNPSEEYGK 175
708 Y K+ + A + E +Y + RR ++ E K
709 Sbjct: 34 PEYEPHGIPIFYDGREFKMTPEEEEVATM--FAVMKEHDYYRMEVFRRNFFESWREILDK 91
710
711 Query: 176 ILEVVGRYSVH 186
712 + R +
713 Sbjct: 92 RQHPIRRLELC 102
714
715
716 >pdb|1FRB|A protein
717 Length = 315
718
719 Score = 27.9 bits (61), Expect = 2.6, Method: Composition-based stats.
720 Identities = 7/22 (31%), Positives = 11/22 (50%)
721
722 Query: 27 RPANAIKEMIENCLDAKSTSIQ 48
723 P N +KE ++ +DA I
724 Sbjct: 22 SPPNQVKEAVKAAIDAGYRHID 43
725
726
727 >pdb|2E5W|A B C D protein
728 Length = 280
729
730 Score = 27.5 bits (60), Expect = 3.2, Method: Composition-based stats.
731 Identities = 17/86 (19%), Positives = 30/86 (34%), Gaps = 22/86 (25%)
732
733 Query: 259 LLFINHRLVESTSLRKAIETVYAAYLPKNTH--PFLYL--------SLEISPQN------ 302
734 LF + L +RK + VY P + P+ +L +++ +
735 Sbjct: 199 YLFTDEFLTAYRKMRKVFDKVYYYSFPVIGYASPWAFLVGVKGSIDFMKVDAEKGKKLGL 258
736
737 Query: 303 --VDVNVHPTKHEVHFLHEESILERV 326
738 D P KHE F I++ +
739 Sbjct: 259 EYYD----PDKHETLFQMPRYIVQML 280
740
741
742 >pdb|2E3N|A protein
743 Length = 255
744
745 Score = 27.5 bits (60), Expect = 3.4, Method: Composition-based stats.
746 Identities = 8/45 (17%), Positives = 13/45 (28%), Gaps = 2/45 (4%)
747
748 Query: 120 ADGKCAYRASYSDGKLKAPPKPCAGNQG--TQITVEDLFYNIATR 162
749 YR + + P T V + F+N+ R
750 Sbjct: 55 EGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVR 99
751
752
753 >pdb|1KQF|A protein
754 Length = 1015
755
756 Score = 26.7 bits (58), Expect = 6.1, Method: Composition-based stats.
757 Identities = 10/47 (21%), Positives = 22/47 (46%), Gaps = 7/47 (14%)
758
759 Query: 19 IAAGEVIQRPANAIKEMIENC-LDAKSTSIQVIVKEGGLKLIQIQDN 64
760 I +G I + ++ +IEN ++A+ VK + ++D+
761 Sbjct: 275 IRSGTDITFLSGVLRYLIENNKINAEY------VKHYTNASLLVRDD 315
762
763
764 >pdb|1I58|A B protein
765 Length = 189
766
767 Score = 26.7 bits (58), Expect = 7.0, Method: Composition-based stats.
768 Identities = 7/13 (53%), Positives = 11/13 (84%)
769
770 Query: 59 IQIQDNGTGIRKE 71
771 I+++D+G GI KE
772 Sbjct: 94 IEVEDDGRGIDKE 106
773
774
775 >pdb|1U3D|A protein
776 Length = 509
777
778 Score = 26.3 bits (57), Expect = 7.7, Method: Composition-based stats.
779 Identities = 9/68 (13%), Positives = 26/68 (38%)
780
781 Query: 222 NAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYA 281
782 + + + + + + + + +S FIN L+E + R+ ++
783 Sbjct: 188 SKCVADPLVFEDDSEKGSNALLARAWSPGWSNGDKALTTFINGPLLEYSKNRRKADSATT 247
784
785 Query: 282 AYLPKNTH 289
786 ++L + H
787 Sbjct: 248 SFLSPHLH 255
788
789
790 >pdb|1B3Q|A B protein
791 Length = 379
792
793 Score = 26.3 bits (57), Expect = 8.0, Method: Composition-based stats.
794 Identities = 7/13 (53%), Positives = 11/13 (84%)
795
796 Query: 59 IQIQDNGTGIRKE 71
797 I+++D+G GI KE
798 Sbjct: 153 IEVEDDGRGIDKE 165
799
800
801 >pdb|2CH4|A B protein
802 Length = 320
803
804 Score = 26.3 bits (57), Expect = 8.0, Method: Composition-based stats.
805 Identities = 7/13 (53%), Positives = 11/13 (84%)
806
807 Query: 59 IQIQDNGTGIRKE 71
808 I+++D+G GI KE
809 Sbjct: 94 IEVEDDGRGIDKE 106
810
811
812 Database: seqs_pdbase_20080903.fix.reps.fa
813 Posted date: Sep 3, 2008 11:00 PM
814 Number of letters in database: 4,636,376
815 Number of sequences in database: 20,430
816
817 Lambda K H
818 0.313 0.159 0.438
819
820 Lambda K H
821 0.267 0.0489 0.140
822
823
824 Matrix: BLOSUM62
825 Gap Penalties: Existence: 11, Extension: 1
826 Number of Hits to DB: 3,264,006
827 Number of Sequences: 20430
828 Number of extensions: 165207
829 Number of successful extensions: 490
830 Number of sequences better than 10.0: 41
831 Number of HSP's better than 10.0 without gapping: 15
832 Number of HSP's successfully gapped in prelim test: 26
833 Number of HSP's that attempted gapping in prelim test: 435
834 Number of HSP's gapped (non-prelim): 43
835 length of query: 340
836 length of database: 4,636,376
837 effective HSP length: 92
838 effective length of query: 248
839 effective length of database: 2,756,816
840 effective search space: 683690368
841 effective search space used: 683690368
842 T: 11
843 A: 40
844 X1: 16 ( 7.2 bits)
845 X2: 38 (14.6 bits)
846 X3: 64 (24.7 bits)
847 S1: 41 (21.2 bits)
848 S2: 57 (26.3 bits)