ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/modelit/server/results/MLH1_WT_1-340/MLH1_WT_1-340.pdb-psiblast.out
Revision: 1299
Committed: Tue Jan 11 17:38:33 2011 UTC (9 years, 8 months ago) by hstehr
File size: 59972 byte(s)
Log Message:
adding Model-It server files to repository
Line User Rev File contents
1 hstehr 1299 <?xml version="1.0"?>
2     <!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
3     <BlastOutput>
4     <BlastOutput_program>blastp</BlastOutput_program>
5     <BlastOutput_version>blastp 2.2.18 [Mar-02-2008]</BlastOutput_version>
6     <BlastOutput_reference>~Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, ~Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), ~&quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search~programs&quot;, Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
7     <BlastOutput_db>/project/StruPPi/CASP8/blast_dbs/seqs_pdbase_20080903.fix.reps.fa</BlastOutput_db>
8     <BlastOutput_query-ID>lcl|QUERY</BlastOutput_query-ID>
9     <BlastOutput_query-def>MLH1_HUMAN P40692 DNA mismatch repair protein Mlh1 OS=Homo sapiens GN=MLH1 PE=1 SV=1</BlastOutput_query-def>
10     <BlastOutput_query-len>340</BlastOutput_query-len>
11     <BlastOutput_param>
12     <Parameters>
13     <Parameters_matrix>BLOSUM62</Parameters_matrix>
14     <Parameters_expect>10</Parameters_expect>
15     <Parameters_gap-open>11</Parameters_gap-open>
16     <Parameters_gap-extend>1</Parameters_gap-extend>
17     <Parameters_filter>F</Parameters_filter>
18     </Parameters>
19     </BlastOutput_param>
20     <BlastOutput_iterations>
21     <Iteration>
22     <Iteration_iter-num>1</Iteration_iter-num>
23     <Iteration_hits>
24     <Hit>
25     <Hit_num>1</Hit_num>
26     <Hit_id>gnl|BL_ORD_ID|399</Hit_id>
27     <Hit_def>pdb|1B63|A protein</Hit_def>
28     <Hit_accession>399</Hit_accession>
29     <Hit_len>333</Hit_len>
30     <Hit_hsps>
31     <Hsp>
32     <Hsp_num>1</Hsp_num>
33     <Hsp_bit-score>420.375</Hsp_bit-score>
34     <Hsp_score>1080</Hsp_score>
35     <Hsp_evalue>2.13404e-118</Hsp_evalue>
36     <Hsp_query-from>8</Hsp_query-from>
37     <Hsp_query-to>335</Hsp_query-to>
38     <Hsp_hit-from>5</Hsp_hit-from>
39     <Hsp_hit-to>333</Hsp_hit-to>
40     <Hsp_query-frame>1</Hsp_query-frame>
41     <Hsp_hit-frame>1</Hsp_hit-frame>
42     <Hsp_identity>116</Hsp_identity>
43     <Hsp_positive>179</Hsp_positive>
44     <Hsp_gaps>1</Hsp_gaps>
45     <Hsp_align-len>329</Hsp_align-len>
46     <Hsp_qseq>IRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVD-NIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLL</Hsp_qseq>
47     <Hsp_hseq>IQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALARHATSKIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQAYAEGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQGVLSVLQ</Hsp_hseq>
48     <Hsp_midline>I+ L + N+IAAGEV++RPA+ +KE++EN LDA +T I + ++ GG KLI+I+DNG GI+K++L + R TSK+ S +DL +I + GFRGEALASIS V+ +T+T++TA+ + A++A + KP A GT + V DLFYN RRK L+ E+ I E++ R ++ ++ ++ G+ V R +P + + +I G A + + I + L + N I ++N R++ + AI L + P L LEI P VDVNVHP KHEV F + + + Q + S L </Hsp_midline>
49     </Hsp>
50     </Hit_hsps>
51     </Hit>
52     <Hit>
53     <Hit_num>2</Hit_num>
54     <Hit_id>gnl|BL_ORD_ID|2567</Hit_id>
55     <Hit_def>pdb|1H7S|A B protein</Hit_def>
56     <Hit_accession>2567</Hit_accession>
57     <Hit_len>365</Hit_len>
58     <Hit_hsps>
59     <Hsp>
60     <Hsp_num>1</Hsp_num>
61     <Hsp_bit-score>353.736</Hsp_bit-score>
62     <Hsp_score>907</Hsp_score>
63     <Hsp_evalue>1.99116e-98</Hsp_evalue>
64     <Hsp_query-from>2</Hsp_query-from>
65     <Hsp_query-to>330</Hsp_query-to>
66     <Hsp_hit-from>9</Hsp_hit-from>
67     <Hsp_hit-to>359</Hsp_hit-to>
68     <Hsp_query-frame>1</Hsp_query-frame>
69     <Hsp_hit-frame>1</Hsp_hit-frame>
70     <Hsp_identity>102</Hsp_identity>
71     <Hsp_positive>180</Hsp_positive>
72     <Hsp_gaps>24</Hsp_gaps>
73     <Hsp_align-len>352</Hsp_align-len>
74     <Hsp_qseq>SFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRK-ALKNPSEEYGKILEVVGRYSVHNAGISFSVKK---QGETVADVRTLPNASTVDNIRSIFGNAVSRELIEI----------------GCEDKTLAFKMNGYISNANYSVKK---CIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHI</Hsp_qseq>
75     <Hsp_hseq>TEPAKAIKPIDRKSVHQICSGQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFADLTQVETFGFRGEALSSLCALSDVTISTCHASAKVGTRLXFDHNGKIIQKTPYPRPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKXVQVLHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENIGSVFGQKQLQSLIPFVQLPPSDSVCEEYGLSCSDALHNLFYISGFISQCTHGVGRSSTDRQFFFINRRPCDPAKVCRLVNEVYHXY-NRHQYPFVVLNISVDSECVDINVTPDKRQILLQEEKLLLAVLKTSL</Hsp_hseq>
76     <Hsp_midline>+ A I+ +D V++I +G+V+ + A+KE++EN LDA +T+I + +K+ G+ LI++ DNG G+ +E+ + + + TSK+Q F DL + T+GFRGEAL+S+ ++ VTI+T A K R + P +GT ++V+ LF + R K +N +EY K ++V+ Y + +AGI S QG+ V T + S +NI S+FG + LI + F ++G+IS + V + FIN R + + + + VY Y ++ +PF+ L++ + + VD+NV P K ++ E+ +L ++ +</Hsp_midline>
77     </Hsp>
78     </Hit_hsps>
79     </Hit>
80     <Hit>
81     <Hit_num>3</Hit_num>
82     <Hit_id>gnl|BL_ORD_ID|6742</Hit_id>
83     <Hit_def>pdb|1S16|A B protein</Hit_def>
84     <Hit_accession>6742</Hit_accession>
85     <Hit_len>390</Hit_len>
86     <Hit_hsps>
87     <Hsp>
88     <Hsp_num>1</Hsp_num>
89     <Hsp_bit-score>188.1</Hsp_bit-score>
90     <Hsp_score>477</Hsp_score>
91     <Hsp_evalue>1.59934e-48</Hsp_evalue>
92     <Hsp_query-from>2</Hsp_query-from>
93     <Hsp_query-to>284</Hsp_query-to>
94     <Hsp_hit-from>4</Hsp_hit-from>
95     <Hsp_hit-to>295</Hsp_hit-to>
96     <Hsp_query-frame>1</Hsp_query-frame>
97     <Hsp_hit-frame>1</Hsp_hit-frame>
98     <Hsp_identity>39</Hsp_identity>
99     <Hsp_positive>90</Hsp_positive>
100     <Hsp_gaps>31</Hsp_gaps>
101     <Hsp_align-len>303</Hsp_align-len>
102     <Hsp_qseq>SFVAGVIRRLDETVVNRIAAGEVI--QRPANAIKEMIENCLD----AKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLD---------IVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRL-----VESTSLRKAIETVYAAYL</Hsp_qseq>
103     <Hsp_hseq>TYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHAD--QSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGK---FSNKNYQFSGGLHGVGISVVNALSKRVEVNVRRDGQV-YNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPD---ETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQDGLNDYLAEAVNGLPTLPEKPFIGNFAGDTEAVDWALLWLPEGGE--LLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFC</Hsp_hseq>
104     <Hsp_midline>++ A I L R G RP + +E+I+N +D + + VI+ + +++ D+G G+ + I+C K F + + G G ++ ++ ++ DG+ Y ++ +G+ + F+ +P ++ V+ +V G+ + K + + ++ G E IG + + ++N LR+ + + </Hsp_midline>
105     </Hsp>
106     </Hit_hsps>
107     </Hit>
108     <Hit>
109     <Hit_num>4</Hit_num>
110     <Hit_id>gnl|BL_ORD_ID|1540</Hit_id>
111     <Hit_def>pdb|1EI1|A B protein</Hit_def>
112     <Hit_accession>1540</Hit_accession>
113     <Hit_len>391</Hit_len>
114     <Hit_hsps>
115     <Hsp>
116     <Hsp_num>1</Hsp_num>
117     <Hsp_bit-score>169.995</Hsp_bit-score>
118     <Hsp_score>430</Hsp_score>
119     <Hsp_evalue>4.85864e-43</Hsp_evalue>
120     <Hsp_query-from>8</Hsp_query-from>
121     <Hsp_query-to>285</Hsp_query-to>
122     <Hsp_hit-from>9</Hsp_hit-from>
123     <Hsp_hit-to>293</Hsp_hit-to>
124     <Hsp_query-frame>1</Hsp_query-frame>
125     <Hsp_hit-frame>1</Hsp_hit-frame>
126     <Hsp_identity>41</Hsp_identity>
127     <Hsp_positive>86</Hsp_positive>
128     <Hsp_gaps>35</Hsp_gaps>
129     <Hsp_align-len>299</Hsp_align-len>
130     <Hsp_qseq>IRRLDETVVNRIAAGEVI------QRPANAIKEMIENCLD---AKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLD---------IVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKK--QGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKA-IETVYAAYLP</Hsp_qseq>
131     <Hsp_hseq>IKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCK-EIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGK---FDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQI-YEHGVPQAPLAVTGETEKTGTMVRF----WPSLETFTNVTEFEYEILAKRLRELSFLDSGVSIRLRDKRDGKED-HFHYEGGIKAFVEYLNKNKTPIHPNIFYFSTEKDGIGVEV----ALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLN</Hsp_hseq>
132     <Hsp_midline>I+ L R G I + + E+++N +D A ++IV + +QD+G GI I+ K F+D + + G G ++ ++ ++ +GK + Y G +AP + T V + EY + + + S ++G+S ++ G+ + + + E + ++ + + F N+ A L </Hsp_midline>
133     </Hsp>
134     </Hit_hsps>
135     </Hit>
136     <Hit>
137     <Hit_num>5</Hit_num>
138     <Hit_id>gnl|BL_ORD_ID|189</Hit_id>
139     <Hit_def>pdb|1AJ6|A protein</Hit_def>
140     <Hit_accession>189</Hit_accession>
141     <Hit_len>219</Hit_len>
142     <Hit_hsps>
143     <Hsp>
144     <Hsp_num>1</Hsp_num>
145     <Hsp_bit-score>145.728</Hsp_bit-score>
146     <Hsp_score>367</Hsp_score>
147     <Hsp_evalue>9.65017e-36</Hsp_evalue>
148     <Hsp_query-from>2</Hsp_query-from>
149     <Hsp_query-to>209</Hsp_query-to>
150     <Hsp_hit-from>3</Hsp_hit-from>
151     <Hsp_hit-to>219</Hsp_hit-to>
152     <Hsp_query-frame>1</Hsp_query-frame>
153     <Hsp_hit-frame>1</Hsp_hit-frame>
154     <Hsp_identity>38</Hsp_identity>
155     <Hsp_positive>76</Hsp_positive>
156     <Hsp_gaps>27</Hsp_gaps>
157     <Hsp_align-len>226</Hsp_align-len>
158     <Hsp_qseq>SFVAGVIRRLDETVVNRIAAGEVI------QRPANAIKEMIENCLD---AKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLD---------IVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPN</Hsp_qseq>
159     <Hsp_hseq>SYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCK-EIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGK---FDDNSYKVSGGLHGVGVSVVNALSQKLELVIQHEGKIHRQI-YEHGVPQAPLAVTGETEKTGTMVRF----WPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEG</Hsp_hseq>
160     <Hsp_midline>S+ + I+ L R G I + + E+++N +D A ++IV + +QD+G GI I+ K F+D + + G G ++ ++ ++ +GK + Y G +AP + T V + EY + + + S N+G+S ++ + + D </Hsp_midline>
161     </Hsp>
162     </Hit_hsps>
163     </Hit>
164     <Hit>
165     <Hit_num>6</Hit_num>
166     <Hit_id>gnl|BL_ORD_ID|3865</Hit_id>
167     <Hit_def>pdb|1KIJ|A B protein</Hit_def>
168     <Hit_accession>3865</Hit_accession>
169     <Hit_len>390</Hit_len>
170     <Hit_hsps>
171     <Hsp>
172     <Hsp_num>1</Hsp_num>
173     <Hsp_bit-score>128.009</Hsp_bit-score>
174     <Hsp_score>321</Hsp_score>
175     <Hsp_evalue>1.80691e-30</Hsp_evalue>
176     <Hsp_query-from>1</Hsp_query-from>
177     <Hsp_query-to>285</Hsp_query-to>
178     <Hsp_hit-from>1</Hsp_hit-from>
179     <Hsp_hit-to>292</Hsp_hit-to>
180     <Hsp_query-frame>1</Hsp_query-frame>
181     <Hsp_hit-frame>1</Hsp_hit-frame>
182     <Hsp_identity>52</Hsp_identity>
183     <Hsp_positive>98</Hsp_positive>
184     <Hsp_gaps>37</Hsp_gaps>
185     <Hsp_align-len>307</Hsp_align-len>
186     <Hsp_qseq>MSFVAGVIRRLDETVVNRIAAGEVI-----QRPANAIKEMIENCLD---AK-STSIQVIVKEGGLKLIQIQDNGTGIRKEDLD---IVCERFTTSKLQSFEDLA---SISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGIS--FSVKKQGETVADVRTLPNASTVDNIRS----IFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLR-KAIETVYAAYLP</Hsp_qseq>
187     <Hsp_hseq>MSYDASAIRVLKGLEGVRHRPAMYIGGTGVEGYHHLFKEILDNAVDEALAGYATEILVRLNEDG--SLTVEDNGRGIPVDLMPEEGKPAVEVIYNTLHSGGKFEQGAYKVSGGLHGVGASVVNALSEWTVVEVFREGKHH-RIAFSRGEVTEPLRVVGEAPRGKTGTRVTFKPDP---EIFGNLRFDPSKIRARLREVAYLVAGLKLVFQDRQHGKEEVFLDKGGVASFAKALAEGEDLLYEKPFLIRGTHGEVEVEVGFLHTQGY---------NAEILTYANMIPTRDGGTHLTAFKSAYSRALN</Hsp_hseq>
188     <Hsp_midline>MS+ A IR L R I + + KE+++N +D A +T I V + E G + ++DNG GI + + + L S + G G + ++ ++ T+ +GK R ++S G++ P + + F + N + KI + + AG+ F ++ G+ + AS + ++ E + GY L + N A ++ Y+ L </Hsp_midline>
189     </Hsp>
190     </Hit_hsps>
191     </Hit>
192     <Hit>
193     <Hit_num>7</Hit_num>
194     <Hit_id>gnl|BL_ORD_ID|6741</Hit_id>
195     <Hit_def>pdb|1S14|A B protein</Hit_def>
196     <Hit_accession>6741</Hit_accession>
197     <Hit_len>194</Hit_len>
198     <Hit_hsps>
199     <Hsp>
200     <Hsp_num>1</Hsp_num>
201     <Hsp_bit-score>119.149</Hsp_bit-score>
202     <Hsp_score>298</Hsp_score>
203     <Hsp_evalue>9.43346e-28</Hsp_evalue>
204     <Hsp_query-from>2</Hsp_query-from>
205     <Hsp_query-to>209</Hsp_query-to>
206     <Hsp_hit-from>4</Hsp_hit-from>
207     <Hsp_hit-to>194</Hsp_hit-to>
208     <Hsp_query-frame>1</Hsp_query-frame>
209     <Hsp_hit-frame>1</Hsp_hit-frame>
210     <Hsp_identity>26</Hsp_identity>
211     <Hsp_positive>66</Hsp_positive>
212     <Hsp_gaps>35</Hsp_gaps>
213     <Hsp_align-len>217</Hsp_align-len>
214     <Hsp_qseq>SFVAGVIRRLDETVVNRIAAGEVI--QRPANAIKEMIENCLD----AKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLD---IVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPN</Hsp_qseq>
215     <Hsp_hseq>TYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHAD--QSLEVIDDGRGMPVDIHPEEGVPAVELILC--------------------ISVVNALSKRVEVNVRRDGQV-YNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPD---ETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQD</Hsp_hseq>
216     <Hsp_midline>++ A I L R G RP + +E+I+N +D + + VI+ + +++ D+G G+ + + ++ ++ ++ DG+ Y ++ +G+ + F+ +P ++ V+ +V G+ + K + +</Hsp_midline>
217     </Hsp>
218     </Hit_hsps>
219     </Hit>
220     <Hit>
221     <Hit_num>8</Hit_num>
222     <Hit_id>gnl|BL_ORD_ID|17211</Hit_id>
223     <Hit_def>pdb|2Q2E|B protein</Hit_def>
224     <Hit_accession>17211</Hit_accession>
225     <Hit_len>621</Hit_len>
226     <Hit_hsps>
227     <Hsp>
228     <Hsp_num>1</Hsp_num>
229     <Hsp_bit-score>59.0579</Hsp_bit-score>
230     <Hsp_score>142</Hsp_score>
231     <Hsp_evalue>1.18789e-09</Hsp_evalue>
232     <Hsp_query-from>27</Hsp_query-from>
233     <Hsp_query-to>209</Hsp_query-to>
234     <Hsp_hit-from>37</Hsp_hit-from>
235     <Hsp_hit-to>225</Hsp_hit-to>
236     <Hsp_query-frame>1</Hsp_query-frame>
237     <Hsp_hit-frame>1</Hsp_hit-frame>
238     <Hsp_identity>37</Hsp_identity>
239     <Hsp_positive>69</Hsp_positive>
240     <Hsp_gaps>36</Hsp_gaps>
241     <Hsp_align-len>204</Hsp_align-len>
242     <Hsp_qseq>RPANAIKEMIENCLDAKSTS-----IQVIVKEGGLKLIQIQ--DNGTGIRKEDLDIVCER-FTTSKLQSFEDLASISTYGFRGEALASISHVAHVT------ITTKTADGKCAYRASY-------SDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPN</Hsp_qseq>
243     <Hsp_hseq>SLITTVKEAVDNALDACEEAGILPDILVQVERTGPDYVTVIIEDNGPGIVREQIPKVFAKLLYGSRFHAL-----KQSRGQQGIGISAAVLYAQMTAGRHTKILSKTSPTAPAHYYELMINTSTNEPDILVDEVRDWFRPHGTQIELEMRAAYVKGRRQS----------IYEYLKATAIVNPHARITLIDPDGNEEVFERATD</Hsp_hseq>
244     <Hsp_midline> +KE ++N LDA + I V V+ G + + DNG GI +E + V + S+ + + G +G +++ A +T I +KT+ A+ L + GTQI +E + RR++ I E + ++ N ++ +</Hsp_midline>
245     </Hsp>
246     </Hit_hsps>
247     </Hit>
248     <Hit>
249     <Hit_num>9</Hit_num>
250     <Hit_id>gnl|BL_ORD_ID|4654</Hit_id>
251     <Hit_def>pdb|1MU5|A protein</Hit_def>
252     <Hit_accession>4654</Hit_accession>
253     <Hit_len>471</Hit_len>
254     <Hit_hsps>
255     <Hsp>
256     <Hsp_num>1</Hsp_num>
257     <Hsp_bit-score>54.8207</Hsp_bit-score>
258     <Hsp_score>131</Hsp_score>
259     <Hsp_evalue>2.29705e-08</Hsp_evalue>
260     <Hsp_query-from>28</Hsp_query-from>
261     <Hsp_query-to>196</Hsp_query-to>
262     <Hsp_hit-from>33</Hsp_hit-from>
263     <Hsp_hit-to>208</Hsp_hit-to>
264     <Hsp_query-frame>1</Hsp_query-frame>
265     <Hsp_hit-frame>1</Hsp_hit-frame>
266     <Hsp_identity>33</Hsp_identity>
267     <Hsp_positive>63</Hsp_positive>
268     <Hsp_gaps>45</Hsp_gaps>
269     <Hsp_align-len>195</Hsp_align-len>
270     <Hsp_qseq>PANAIKEMIENCLDAKST---------SIQVIVKEGGLK--LIQIQDNGTGIRKEDLDIVCER-FTTSKLQSFEDLASISTYGFRGEALASISHVAHV------TITTKTADGKCAY----RASYSDGKLK----APPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKK</Hsp_qseq>
271     <Hsp_hseq>LYQTVRELIENSLDA--TDVHGILPNIKITIDLIDDARQIYKVNVVDNGIGIPPQEVPNAFGRVLYSSKY------VNRQTRGMYGLGVKAAVLYSQMHQDKPIEIETSPVNSKRIYTFKLKIDINKNEPIIVERGSVENTRGFHGTSVAIS-----IPG------DWPKAKSRIYEYIKRTYIITPYAEFIFKD</Hsp_hseq>
272     <Hsp_midline> ++E+IEN LDA T I + + + + + + DNG GI +++ R +SK + T G G + + + + I T + K Y + + + + G GT + + I + + +I E + R + F K </Hsp_midline>
273     </Hsp>
274     </Hit_hsps>
275     </Hit>
276     <Hit>
277     <Hit_num>10</Hit_num>
278     <Hit_id>gnl|BL_ORD_ID|18946</Hit_id>
279     <Hit_def>pdb|2ZBK|B D F H protein</Hit_def>
280     <Hit_accession>18946</Hit_accession>
281     <Hit_len>530</Hit_len>
282     <Hit_hsps>
283     <Hsp>
284     <Hsp_num>1</Hsp_num>
285     <Hsp_bit-score>54.4355</Hsp_bit-score>
286     <Hsp_score>130</Hsp_score>
287     <Hsp_evalue>2.95039e-08</Hsp_evalue>
288     <Hsp_query-from>28</Hsp_query-from>
289     <Hsp_query-to>196</Hsp_query-to>
290     <Hsp_hit-from>32</Hsp_hit-from>
291     <Hsp_hit-to>207</Hsp_hit-to>
292     <Hsp_query-frame>1</Hsp_query-frame>
293     <Hsp_hit-frame>1</Hsp_hit-frame>
294     <Hsp_identity>33</Hsp_identity>
295     <Hsp_positive>63</Hsp_positive>
296     <Hsp_gaps>45</Hsp_gaps>
297     <Hsp_align-len>195</Hsp_align-len>
298     <Hsp_qseq>PANAIKEMIENCLDAKST---------SIQVIVKEGGLK--LIQIQDNGTGIRKEDLDIVCER-FTTSKLQSFEDLASISTYGFRGEALASISHVAHV------TITTKTADGKCAY----RASYSDGKLK----APPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKK</Hsp_qseq>
299     <Hsp_hseq>LYQTVRELIENSLDA--TDVHGILPNIKITIDLIDDARQIYKVNVVDNGIGIPPQEVPNAFGRVLYSSKY------VNRQTRGMYGLGVKAAVLYSQMHQDKPIEIETSPVNSKRIYTFKLKIDINKNEPIIVERGSVENTRGFHGTSVAIS-----IPG------DWPKAKSRIYEYIKRTYIITPYAEFIFKD</Hsp_hseq>
300     <Hsp_midline> ++E+IEN LDA T I + + + + + + DNG GI +++ R +SK + T G G + + + + I T + K Y + + + + G GT + + I + + +I E + R + F K </Hsp_midline>
301     </Hsp>
302     </Hit_hsps>
303     </Hit>
304     <Hit>
305     <Hit_num>11</Hit_num>
306     <Hit_id>gnl|BL_ORD_ID|16138</Hit_id>
307     <Hit_def>pdb|2O1U|A B protein</Hit_def>
308     <Hit_accession>16138</Hit_accession>
309     <Hit_len>666</Hit_len>
310     <Hit_hsps>
311     <Hsp>
312     <Hsp_num>1</Hsp_num>
313     <Hsp_bit-score>45.1907</Hsp_bit-score>
314     <Hsp_score>106</Hsp_score>
315     <Hsp_evalue>1.56624e-05</Hsp_evalue>
316     <Hsp_query-from>37</Hsp_query-from>
317     <Hsp_query-to>307</Hsp_query-to>
318     <Hsp_hit-from>72</Hsp_hit-from>
319     <Hsp_hit-to>358</Hsp_hit-to>
320     <Hsp_query-frame>1</Hsp_query-frame>
321     <Hsp_hit-frame>1</Hsp_hit-frame>
322     <Hsp_identity>53</Hsp_identity>
323     <Hsp_positive>96</Hsp_positive>
324     <Hsp_gaps>66</Hsp_gaps>
325     <Hsp_align-len>312</Hsp_align-len>
326     <Hsp_qseq>ENCLDAKSTSIQVIVK-EGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSF--------EDLASISTY-GFRGEALASISHVA-HVTITTKTADGKCA-YRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS-VHNAGI---------------SFSVKKQGETVADVRTLP-NASTVDNIRSIFGNAVSRELIEIGCEDKTL-AFKMNGYIS--------NANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSL---EISPQNVDVNV</Hsp_qseq>
327     <Hsp_hseq>ENAL-AGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLV---------LKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGGGGKTVWDWELMNDIKPIWQRPSKEVEDDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDD---------FHDMMPK------YLNFVKGVVDSDDLPLNV</Hsp_hseq>
328     <Hsp_midline>EN L A + + V +K + L+ + D G G+ +E+L S F ED S S G G S VA V +T+K + + + ++ + A P+ +GT IT+ K + E I +V +YS N I + + + + + F + I + FK ++ + S K L++ + + +PK YL+ + ++ +NV</Hsp_midline>
329     </Hsp>
330     </Hit_hsps>
331     </Hit>
332     <Hit>
333     <Hit_num>12</Hit_num>
334     <Hit_id>gnl|BL_ORD_ID|16139</Hit_id>
335     <Hit_def>pdb|2O1W|A B C D E protein</Hit_def>
336     <Hit_accession>16139</Hit_accession>
337     <Hit_len>506</Hit_len>
338     <Hit_hsps>
339     <Hsp>
340     <Hsp_num>1</Hsp_num>
341     <Hsp_bit-score>45.1907</Hsp_bit-score>
342     <Hsp_score>106</Hsp_score>
343     <Hsp_evalue>1.89759e-05</Hsp_evalue>
344     <Hsp_query-from>37</Hsp_query-from>
345     <Hsp_query-to>307</Hsp_query-to>
346     <Hsp_hit-from>72</Hsp_hit-from>
347     <Hsp_hit-to>358</Hsp_hit-to>
348     <Hsp_query-frame>1</Hsp_query-frame>
349     <Hsp_hit-frame>1</Hsp_hit-frame>
350     <Hsp_identity>53</Hsp_identity>
351     <Hsp_positive>96</Hsp_positive>
352     <Hsp_gaps>66</Hsp_gaps>
353     <Hsp_align-len>312</Hsp_align-len>
354     <Hsp_qseq>ENCLDAKSTSIQVIVK-EGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSF--------EDLASISTY-GFRGEALASISHVA-HVTITTKTADGKCA-YRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS-VHNAGI---------------SFSVKKQGETVADVRTLP-NASTVDNIRSIFGNAVSRELIEIGCEDKTL-AFKMNGYIS--------NANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSL---EISPQNVDVNV</Hsp_qseq>
355     <Hsp_hseq>ENAL-AGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLV---------LKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGGGGKTVWDWELMNDIKPIWQRPSKEVEDDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDD---------FHDMMPK------YLNFVKGVVDSDDLPLNV</Hsp_hseq>
356     <Hsp_midline>EN L A + + V +K + L+ + D G G+ +E+L S F ED S S G G S VA V +T+K + + + ++ + A P+ +GT IT+ K + E I +V +YS N I + + + + + F + I + FK ++ + S K L++ + + +PK YL+ + ++ +NV</Hsp_midline>
357     </Hsp>
358     </Hit_hsps>
359     </Hit>
360     <Hit>
361     <Hit_num>13</Hit_num>
362     <Hit_id>gnl|BL_ORD_ID|14203</Hit_id>
363     <Hit_def>pdb|2GQP|A B protein</Hit_def>
364     <Hit_accession>14203</Hit_accession>
365     <Hit_len>236</Hit_len>
366     <Hit_hsps>
367     <Hsp>
368     <Hsp_num>1</Hsp_num>
369     <Hsp_bit-score>44.4203</Hsp_bit-score>
370     <Hsp_score>104</Hsp_score>
371     <Hsp_evalue>2.6274e-05</Hsp_evalue>
372     <Hsp_query-from>37</Hsp_query-from>
373     <Hsp_query-to>184</Hsp_query-to>
374     <Hsp_hit-from>59</Hsp_hit-from>
375     <Hsp_hit-to>208</Hsp_hit-to>
376     <Hsp_query-frame>1</Hsp_query-frame>
377     <Hsp_hit-frame>1</Hsp_hit-frame>
378     <Hsp_identity>38</Hsp_identity>
379     <Hsp_positive>61</Hsp_positive>
380     <Hsp_gaps>22</Hsp_gaps>
381     <Hsp_align-len>160</Hsp_align-len>
382     <Hsp_qseq>ENCLDAKSTSIQVIVK-EGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSF--------EDLASISTY-GFRGEALASISHVA-HVTITTKTADGKCA-YRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS</Hsp_qseq>
383     <Hsp_hseq>ENAL-AGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLV---------LKEEASDYLELDTIKNLVKKYS</Hsp_hseq>
384     <Hsp_midline>EN L A + + V +K + L+ + D G G+ +E+L S F ED S S G G S VA V +T+K + + + ++ + A P+ +GT IT+ K + E I +V +YS</Hsp_midline>
385     </Hsp>
386     </Hit_hsps>
387     </Hit>
388     <Hit>
389     <Hit_num>14</Hit_num>
390     <Hit_id>gnl|BL_ORD_ID|6295</Hit_id>
391     <Hit_def>pdb|1QY5|A protein</Hit_def>
392     <Hit_accession>6295</Hit_accession>
393     <Hit_len>269</Hit_len>
394     <Hit_hsps>
395     <Hsp>
396     <Hsp_num>1</Hsp_num>
397     <Hsp_bit-score>44.0351</Hsp_bit-score>
398     <Hsp_score>103</Hsp_score>
399     <Hsp_evalue>3.66836e-05</Hsp_evalue>
400     <Hsp_query-from>37</Hsp_query-from>
401     <Hsp_query-to>184</Hsp_query-to>
402     <Hsp_hit-from>55</Hsp_hit-from>
403     <Hsp_hit-to>204</Hsp_hit-to>
404     <Hsp_query-frame>1</Hsp_query-frame>
405     <Hsp_hit-frame>1</Hsp_hit-frame>
406     <Hsp_identity>38</Hsp_identity>
407     <Hsp_positive>61</Hsp_positive>
408     <Hsp_gaps>22</Hsp_gaps>
409     <Hsp_align-len>160</Hsp_align-len>
410     <Hsp_qseq>ENCLDAKSTSIQVIVK-EGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSF--------EDLASISTY-GFRGEALASISHVA-HVTITTKTADGKCA-YRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS</Hsp_qseq>
411     <Hsp_hseq>ENAL-AGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLV---------LKEEASDYLELDTIKNLVKKYS</Hsp_hseq>
412     <Hsp_midline>EN L A + + V +K + L+ + D G G+ +E+L S F ED S S G G S VA V +T+K + + + ++ + A P+ +GT IT+ K + E I +V +YS</Hsp_midline>
413     </Hsp>
414     </Hit_hsps>
415     </Hit>
416     <Hit>
417     <Hit_num>15</Hit_num>
418     <Hit_id>gnl|BL_ORD_ID|9861</Hit_id>
419     <Hit_def>pdb|1YC1|A protein</Hit_def>
420     <Hit_accession>9861</Hit_accession>
421     <Hit_len>264</Hit_len>
422     <Hit_hsps>
423     <Hsp>
424     <Hsp_num>1</Hsp_num>
425     <Hsp_bit-score>41.7239</Hsp_bit-score>
426     <Hsp_score>97</Hsp_score>
427     <Hsp_evalue>0.000206332</Hsp_evalue>
428     <Hsp_query-from>32</Hsp_query-from>
429     <Hsp_query-to>184</Hsp_query-to>
430     <Hsp_hit-from>73</Hsp_hit-from>
431     <Hsp_hit-to>239</Hsp_hit-to>
432     <Hsp_query-frame>1</Hsp_query-frame>
433     <Hsp_hit-frame>1</Hsp_hit-frame>
434     <Hsp_identity>40</Hsp_identity>
435     <Hsp_positive>59</Hsp_positive>
436     <Hsp_gaps>38</Hsp_gaps>
437     <Hsp_align-len>179</Hsp_align-len>
438     <Hsp_qseq>IKEMIENCLDAKSTSIQVIVK------EGGLKL------------IQIQDNGTGIRKEDL-------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAH-VTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS</Hsp_qseq>
439     <Hsp_hseq>LRELISNSSDA-LDKIRYETLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMI---GQFGVGFYSAYLVAEKVTVITKHNDDEQ-YAWESSAGGSFTVRTDTGEPMGRGTKVILH-------LKEDQTEYLEERRIKEIVKKHS</Hsp_hseq>
440     <Hsp_midline>++E+I N DA I+ + G +L + I D G G+ K DL + LQ+ D++ I G G S VA VT+ TK D + Y S G G V K + E +I E+V ++S</Hsp_midline>
441     </Hsp>
442     </Hit_hsps>
443     </Hit>
444     <Hit>
445     <Hit_num>16</Hit_num>
446     <Hit_id>gnl|BL_ORD_ID|8042</Hit_id>
447     <Hit_def>pdb|1UYL|A protein</Hit_def>
448     <Hit_accession>8042</Hit_accession>
449     <Hit_len>236</Hit_len>
450     <Hit_hsps>
451     <Hsp>
452     <Hsp_num>1</Hsp_num>
453     <Hsp_bit-score>40.1831</Hsp_bit-score>
454     <Hsp_score>93</Hsp_score>
455     <Hsp_evalue>0.000600333</Hsp_evalue>
456     <Hsp_query-from>32</Hsp_query-from>
457     <Hsp_query-to>184</Hsp_query-to>
458     <Hsp_hit-from>45</Hsp_hit-from>
459     <Hsp_hit-to>211</Hsp_hit-to>
460     <Hsp_query-frame>1</Hsp_query-frame>
461     <Hsp_hit-frame>1</Hsp_hit-frame>
462     <Hsp_identity>40</Hsp_identity>
463     <Hsp_positive>59</Hsp_positive>
464     <Hsp_gaps>38</Hsp_gaps>
465     <Hsp_align-len>179</Hsp_align-len>
466     <Hsp_qseq>IKEMIENCLDAKSTSIQVIVK------EGGLKL------------IQIQDNGTGIRKEDL-------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAH-VTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS</Hsp_qseq>
467     <Hsp_hseq>LRELISNSSDA-LDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMI---GQFGVGFYSAYLVAEKVTVITKHNDDEQ-YAWESSAGGSFTVRTDTGEPMGRGTKVILH-------LKEDQTEYLEERRIKEIVKKHS</Hsp_hseq>
468     <Hsp_midline>++E+I N DA I+ + G +L + I D G G+ K DL + LQ+ D++ I G G S VA VT+ TK D + Y S G G V K + E +I E+V ++S</Hsp_midline>
469     </Hsp>
470     </Hit_hsps>
471     </Hit>
472     <Hit>
473     <Hit_num>17</Hit_num>
474     <Hit_id>gnl|BL_ORD_ID|11753</Hit_id>
475     <Hit_def>pdb|2CG9|A B protein</Hit_def>
476     <Hit_accession>11753</Hit_accession>
477     <Hit_len>677</Hit_len>
478     <Hit_hsps>
479     <Hsp>
480     <Hsp_num>1</Hsp_num>
481     <Hsp_bit-score>38.2571</Hsp_bit-score>
482     <Hsp_score>88</Hsp_score>
483     <Hsp_evalue>0.00193065</Hsp_evalue>
484     <Hsp_query-from>57</Hsp_query-from>
485     <Hsp_query-to>184</Hsp_query-to>
486     <Hsp_hit-from>73</Hsp_hit-from>
487     <Hsp_hit-to>198</Hsp_hit-to>
488     <Hsp_query-frame>1</Hsp_query-frame>
489     <Hsp_hit-frame>1</Hsp_hit-frame>
490     <Hsp_identity>31</Hsp_identity>
491     <Hsp_positive>53</Hsp_positive>
492     <Hsp_gaps>24</Hsp_gaps>
493     <Hsp_align-len>139</Hsp_align-len>
494     <Hsp_qseq>KLIQIQDNGTGIRKEDL-------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVA-HVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEY---GKILEVVGRYS</Hsp_qseq>
495     <Hsp_hseq>KVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMI---GQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTIL----------RLFLKDDQLEYLEEKRIKEVIKRHS</Hsp_hseq>
496     <Hsp_midline>K+++I+D+G G+ K +L + L + D++ I G G S+ VA V + +K+ D + S + G G + R LK+ EY +I EV+ R+S</Hsp_midline>
497     </Hsp>
498     </Hit_hsps>
499     </Hit>
500     <Hit>
501     <Hit_num>18</Hit_num>
502     <Hit_id>gnl|BL_ORD_ID|15147</Hit_id>
503     <Hit_def>pdb|2IOQ|A B protein</Hit_def>
504     <Hit_accession>15147</Hit_accession>
505     <Hit_len>624</Hit_len>
506     <Hit_hsps>
507     <Hsp>
508     <Hsp_num>1</Hsp_num>
509     <Hsp_bit-score>38.2571</Hsp_bit-score>
510     <Hsp_score>88</Hsp_score>
511     <Hsp_evalue>0.00209865</Hsp_evalue>
512     <Hsp_query-from>32</Hsp_query-from>
513     <Hsp_query-to>151</Hsp_query-to>
514     <Hsp_hit-from>32</Hsp_hit-from>
515     <Hsp_hit-to>177</Hsp_hit-to>
516     <Hsp_query-frame>1</Hsp_query-frame>
517     <Hsp_hit-frame>1</Hsp_hit-frame>
518     <Hsp_identity>29</Hsp_identity>
519     <Hsp_positive>53</Hsp_positive>
520     <Hsp_gaps>28</Hsp_gaps>
521     <Hsp_align-len>147</Hsp_align-len>
522     <Hsp_qseq>IKEMIENCLDA------------------KSTSIQVIVKEGGLKLIQIQDNGTGIRKED----LDIVCERFTTSKLQSFEDLASIST--YGFRGEALASISHVA-HVTITTKTADG--KCAYRASYSDGKLKAPPKPCAGNQGTQIT</Hsp_qseq>
523     <Hsp_hseq>LRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKD-KRTLTISDNGVGMTRDEVIDHLGTIAKSGTKSFLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEIT</Hsp_hseq>
524     <Hsp_midline>++E+I N DA ++V + + + I DNG G+ +++ L + + T S L+S + + G G S VA VT+ T+ A + + ++GT+IT</Hsp_midline>
525     </Hsp>
526     </Hit_hsps>
527     </Hit>
528     <Hit>
529     <Hit_num>19</Hit_num>
530     <Hit_id>gnl|BL_ORD_ID|9751</Hit_id>
531     <Hit_def>pdb|1Y4S|A B protein</Hit_def>
532     <Hit_accession>9751</Hit_accession>
533     <Hit_len>559</Hit_len>
534     <Hit_hsps>
535     <Hsp>
536     <Hsp_num>1</Hsp_num>
537     <Hsp_bit-score>38.2571</Hsp_bit-score>
538     <Hsp_score>88</Hsp_score>
539     <Hsp_evalue>0.00215184</Hsp_evalue>
540     <Hsp_query-from>32</Hsp_query-from>
541     <Hsp_query-to>151</Hsp_query-to>
542     <Hsp_hit-from>32</Hsp_hit-from>
543     <Hsp_hit-to>177</Hsp_hit-to>
544     <Hsp_query-frame>1</Hsp_query-frame>
545     <Hsp_hit-frame>1</Hsp_hit-frame>
546     <Hsp_identity>29</Hsp_identity>
547     <Hsp_positive>53</Hsp_positive>
548     <Hsp_gaps>28</Hsp_gaps>
549     <Hsp_align-len>147</Hsp_align-len>
550     <Hsp_qseq>IKEMIENCLDA------------------KSTSIQVIVKEGGLKLIQIQDNGTGIRKED----LDIVCERFTTSKLQSFEDLASIST--YGFRGEALASISHVA-HVTITTKTADG--KCAYRASYSDGKLKAPPKPCAGNQGTQIT</Hsp_qseq>
551     <Hsp_hseq>LRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKD-KRTLTISDNGVGMTRDEVIDHLGTIAKSGTKSFLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEIT</Hsp_hseq>
552     <Hsp_midline>++E+I N DA ++V + + + I DNG G+ +++ L + + T S L+S + + G G S VA VT+ T+ A + + ++GT+IT</Hsp_midline>
553     </Hsp>
554     </Hit_hsps>
555     </Hit>
556     <Hit>
557     <Hit_num>20</Hit_num>
558     <Hit_id>gnl|BL_ORD_ID|10917</Hit_id>
559     <Hit_def>pdb|2AKP|A B protein</Hit_def>
560     <Hit_accession>10917</Hit_accession>
561     <Hit_len>186</Hit_len>
562     <Hit_hsps>
563     <Hsp>
564     <Hsp_num>1</Hsp_num>
565     <Hsp_bit-score>37.4867</Hsp_bit-score>
566     <Hsp_score>86</Hsp_score>
567     <Hsp_evalue>0.00315862</Hsp_evalue>
568     <Hsp_query-from>57</Hsp_query-from>
569     <Hsp_query-to>184</Hsp_query-to>
570     <Hsp_hit-from>49</Hsp_hit-from>
571     <Hsp_hit-to>174</Hsp_hit-to>
572     <Hsp_query-frame>1</Hsp_query-frame>
573     <Hsp_hit-frame>1</Hsp_hit-frame>
574     <Hsp_identity>31</Hsp_identity>
575     <Hsp_positive>53</Hsp_positive>
576     <Hsp_gaps>24</Hsp_gaps>
577     <Hsp_align-len>139</Hsp_align-len>
578     <Hsp_qseq>KLIQIQDNGTGIRKEDL-------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVA-HVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEY---GKILEVVGRYS</Hsp_qseq>
579     <Hsp_hseq>KVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMI---GQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTIL----------RLFLKDDQLEYLEEKRIKEVIKRHS</Hsp_hseq>
580     <Hsp_midline>K+++I+D+G G+ K +L + L + D++ I G G S+ VA V + +K+ D + S + G G + R LK+ EY +I EV+ R+S</Hsp_midline>
581     </Hsp>
582     </Hit_hsps>
583     </Hit>
584     <Hit>
585     <Hit_num>21</Hit_num>
586     <Hit_id>gnl|BL_ORD_ID|15237</Hit_id>
587     <Hit_def>pdb|2IWX|A protein</Hit_def>
588     <Hit_accession>15237</Hit_accession>
589     <Hit_len>214</Hit_len>
590     <Hit_hsps>
591     <Hsp>
592     <Hsp_num>1</Hsp_num>
593     <Hsp_bit-score>37.4867</Hsp_bit-score>
594     <Hsp_score>86</Hsp_score>
595     <Hsp_evalue>0.00363998</Hsp_evalue>
596     <Hsp_query-from>57</Hsp_query-from>
597     <Hsp_query-to>184</Hsp_query-to>
598     <Hsp_hit-from>73</Hsp_hit-from>
599     <Hsp_hit-to>198</Hsp_hit-to>
600     <Hsp_query-frame>1</Hsp_query-frame>
601     <Hsp_hit-frame>1</Hsp_hit-frame>
602     <Hsp_identity>31</Hsp_identity>
603     <Hsp_positive>53</Hsp_positive>
604     <Hsp_gaps>24</Hsp_gaps>
605     <Hsp_align-len>139</Hsp_align-len>
606     <Hsp_qseq>KLIQIQDNGTGIRKEDL-------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVA-HVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEY---GKILEVVGRYS</Hsp_qseq>
607     <Hsp_hseq>KVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMI---GQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTIL----------RLFLKDDQLEYLEEKRIKEVIKRHS</Hsp_hseq>
608     <Hsp_midline>K+++I+D+G G+ K +L + L + D++ I G G S+ VA V + +K+ D + S + G G + R LK+ EY +I EV+ R+S</Hsp_midline>
609     </Hsp>
610     </Hit_hsps>
611     </Hit>
612     <Hit>
613     <Hit_num>22</Hit_num>
614     <Hit_id>gnl|BL_ORD_ID|15148</Hit_id>
615     <Hit_def>pdb|2IOR|A protein</Hit_def>
616     <Hit_accession>15148</Hit_accession>
617     <Hit_len>235</Hit_len>
618     <Hit_hsps>
619     <Hsp>
620     <Hsp_num>1</Hsp_num>
621     <Hsp_bit-score>37.1015</Hsp_bit-score>
622     <Hsp_score>85</Hsp_score>
623     <Hsp_evalue>0.00430103</Hsp_evalue>
624     <Hsp_query-from>32</Hsp_query-from>
625     <Hsp_query-to>151</Hsp_query-to>
626     <Hsp_hit-from>52</Hsp_hit-from>
627     <Hsp_hit-to>197</Hsp_hit-to>
628     <Hsp_query-frame>1</Hsp_query-frame>
629     <Hsp_hit-frame>1</Hsp_hit-frame>
630     <Hsp_identity>29</Hsp_identity>
631     <Hsp_positive>53</Hsp_positive>
632     <Hsp_gaps>28</Hsp_gaps>
633     <Hsp_align-len>147</Hsp_align-len>
634     <Hsp_qseq>IKEMIENCLDA------------------KSTSIQVIVKEGGLKLIQIQDNGTGIRKED----LDIVCERFTTSKLQSFEDLASIST--YGFRGEALASISHVA-HVTITTKTADG--KCAYRASYSDGKLKAPPKPCAGNQGTQIT</Hsp_qseq>
635     <Hsp_hseq>LRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKD-KRTLTISDNGVGMTRDEVIDHLGTIAKSGTKSFLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEIT</Hsp_hseq>
636     <Hsp_midline>++E+I N DA ++V + + + I DNG G+ +++ L + + T S L+S + + G G S VA VT+ T+ A + + ++GT+IT</Hsp_midline>
637     </Hsp>
638     </Hit_hsps>
639     </Hit>
640     <Hit>
641     <Hit_num>23</Hit_num>
642     <Hit_id>gnl|BL_ORD_ID|10622</Hit_id>
643     <Hit_def>pdb|1ZXM|A B protein</Hit_def>
644     <Hit_accession>10622</Hit_accession>
645     <Hit_len>400</Hit_len>
646     <Hit_hsps>
647     <Hsp>
648     <Hsp_num>1</Hsp_num>
649     <Hsp_bit-score>36.3311</Hsp_bit-score>
650     <Hsp_score>83</Hsp_score>
651     <Hsp_evalue>0.008963</Hsp_evalue>
652     <Hsp_query-from>41</Hsp_query-from>
653     <Hsp_query-to>216</Hsp_query-to>
654     <Hsp_hit-from>71</Hsp_hit-from>
655     <Hsp_hit-to>251</Hsp_hit-to>
656     <Hsp_query-frame>1</Hsp_query-frame>
657     <Hsp_hit-frame>1</Hsp_hit-frame>
658     <Hsp_identity>31</Hsp_identity>
659     <Hsp_positive>61</Hsp_positive>
660     <Hsp_gaps>19</Hsp_gaps>
661     <Hsp_align-len>188</Hsp_align-len>
662     <Hsp_qseq>DAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLD--------IVCERFTTSKLQSFEDLASISTYGFRGEALASISHVA-HVTITTKTADGKCAYR---ASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNI</Hsp_qseq>
663     <Hsp_hseq>DPKMSCIRVTIDPE-NNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTS--SNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCIT----FQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKL</Hsp_hseq>
664     <Hsp_midline>D K + I+V + LI I +NG GI + ++ + TS +++D T G G + + T+ T + + K ++ + KP G T IT F ++ K + ++ + + + V R+ + D +</Hsp_midline>
665     </Hsp>
666     </Hit_hsps>
667     </Hit>
668     <Hit>
669     <Hit_num>24</Hit_num>
670     <Hit_id>gnl|BL_ORD_ID|5852</Hit_id>
671     <Hit_def>pdb|1PVG|A B protein</Hit_def>
672     <Hit_accession>5852</Hit_accession>
673     <Hit_len>418</Hit_len>
674     <Hit_hsps>
675     <Hsp>
676     <Hsp_num>1</Hsp_num>
677     <Hsp_bit-score>32.4791</Hsp_bit-score>
678     <Hsp_score>73</Hsp_score>
679     <Hsp_evalue>0.108623</Hsp_evalue>
680     <Hsp_query-from>24</Hsp_query-from>
681     <Hsp_query-to>101</Hsp_query-to>
682     <Hsp_hit-from>61</Hsp_hit-from>
683     <Hsp_hit-to>148</Hsp_hit-to>
684     <Hsp_query-frame>1</Hsp_query-frame>
685     <Hsp_hit-frame>1</Hsp_hit-frame>
686     <Hsp_identity>17</Hsp_identity>
687     <Hsp_positive>32</Hsp_positive>
688     <Hsp_gaps>16</Hsp_gaps>
689     <Hsp_align-len>91</Hsp_align-len>
690     <Hsp_qseq>VIQRPANAIKEMIENCLDAK-----STSIQVIVKEGGLKLIQIQDNGTGIRKEDL--------DIVCERFTTSKLQSFEDLASISTYGFRG</Hsp_qseq>
691     <Hsp_hseq>IVPGLFKIFDEILVNAADNKVRDPSXKRIDVNIHAEEHT-IEVKNDGKGIPIEIHNKENIYIPEXIFGHLLTS--SNYDDDEKKVTGGRNG</Hsp_hseq>
692     <Hsp_midline>++ E++ N D K I V + I+++++G GI E + + TS +++D T G G</Hsp_midline>
693     </Hsp>
694     </Hit_hsps>
695     </Hit>
696     <Hit>
697     <Hit_num>25</Hit_num>
698     <Hit_id>gnl|BL_ORD_ID|2323</Hit_id>
699     <Hit_def>pdb|1GKZ|A protein</Hit_def>
700     <Hit_accession>2323</Hit_accession>
701     <Hit_len>388</Hit_len>
702     <Hit_hsps>
703     <Hsp>
704     <Hsp_num>1</Hsp_num>
705     <Hsp_bit-score>31.3235</Hsp_bit-score>
706     <Hsp_score>70</Hsp_score>
707     <Hsp_evalue>0.239977</Hsp_evalue>
708     <Hsp_query-from>34</Hsp_query-from>
709     <Hsp_query-to>90</Hsp_query-to>
710     <Hsp_hit-from>245</Hsp_hit-from>
711     <Hsp_hit-to>312</Hsp_hit-to>
712     <Hsp_query-frame>1</Hsp_query-frame>
713     <Hsp_hit-frame>1</Hsp_hit-frame>
714     <Hsp_identity>17</Hsp_identity>
715     <Hsp_positive>30</Hsp_positive>
716     <Hsp_gaps>11</Hsp_gaps>
717     <Hsp_align-len>68</Hsp_align-len>
718     <Hsp_qseq>EMIENCLDA----------KSTSIQVIVKEGGLKLI-QIQDNGTGIRKEDLDIVCERFTTSKLQSFED</Hsp_qseq>
719     <Hsp_hseq>ELLKNAMRATMESHLDTPYNVPDVVITIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQD</Hsp_hseq>
720     <Hsp_midline>E+++N + A + + + + LI +I D G GI +DLD V + T+ S +D</Hsp_midline>
721     </Hsp>
722     </Hit_hsps>
723     </Hit>
724     <Hit>
725     <Hit_num>26</Hit_num>
726     <Hit_id>gnl|BL_ORD_ID|7379</Hit_id>
727     <Hit_def>pdb|1TH8|A protein</Hit_def>
728     <Hit_accession>7379</Hit_accession>
729     <Hit_len>145</Hit_len>
730     <Hit_hsps>
731     <Hsp>
732     <Hsp_num>1</Hsp_num>
733     <Hsp_bit-score>30.9383</Hsp_bit-score>
734     <Hsp_score>69</Hsp_score>
735     <Hsp_evalue>0.300613</Hsp_evalue>
736     <Hsp_query-from>30</Hsp_query-from>
737     <Hsp_query-to>84</Hsp_query-to>
738     <Hsp_hit-from>42</Hsp_hit-from>
739     <Hsp_hit-to>100</Hsp_hit-to>
740     <Hsp_query-frame>1</Hsp_query-frame>
741     <Hsp_hit-frame>1</Hsp_hit-frame>
742     <Hsp_identity>14</Hsp_identity>
743     <Hsp_positive>28</Hsp_positive>
744     <Hsp_gaps>10</Hsp_gaps>
745     <Hsp_align-len>62</Hsp_align-len>
746     <Hsp_qseq>NAIKEMIENCLDAKSTS-------IQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK</Hsp_qseq>
747     <Hsp_hseq>TVVSEAVTNAIIHGYNNDPNGIVSISVIIEDGVVHL-TVRDEGVGIP--DIEEARQPLFTTK</Hsp_hseq>
748     <Hsp_midline> + E + N + + I VI+++G + L ++D G GI D++ + T+K</Hsp_midline>
749     </Hsp>
750     </Hit_hsps>
751     </Hit>
752     <Hit>
753     <Hit_num>27</Hit_num>
754     <Hit_id>gnl|BL_ORD_ID|10088</Hit_id>
755     <Hit_def>pdb|1YSR|A B C protein</Hit_def>
756     <Hit_accession>10088</Hit_accession>
757     <Hit_len>150</Hit_len>
758     <Hit_hsps>
759     <Hsp>
760     <Hsp_num>1</Hsp_num>
761     <Hsp_bit-score>30.1679</Hsp_bit-score>
762     <Hsp_score>67</Hsp_score>
763     <Hsp_evalue>0.53017</Hsp_evalue>
764     <Hsp_query-from>36</Hsp_query-from>
765     <Hsp_query-to>114</Hsp_query-to>
766     <Hsp_hit-from>51</Hsp_hit-from>
767     <Hsp_hit-to>126</Hsp_hit-to>
768     <Hsp_query-frame>1</Hsp_query-frame>
769     <Hsp_hit-frame>1</Hsp_hit-frame>
770     <Hsp_identity>20</Hsp_identity>
771     <Hsp_positive>38</Hsp_positive>
772     <Hsp_gaps>17</Hsp_gaps>
773     <Hsp_align-len>86</Hsp_align-len>
774     <Hsp_qseq>IENCL-----DAKSTSIQVI--VKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVT</Hsp_qseq>
775     <Hsp_hseq>VDNAIANAVKHGGATLVQLSAVSSRAGVE-IAIDDNGSGVPEGERQVVFER--------FSRGSTASHSG-SGLGLALVAQQAQLH</Hsp_hseq>
776     <Hsp_midline>++N + +T +Q+ G++ I I DNG+G+ + + +V ER F ++ S G G LA ++ A + </Hsp_midline>
777     </Hsp>
778     </Hit_hsps>
779     </Hit>
780     <Hit>
781     <Hit_num>28</Hit_num>
782     <Hit_id>gnl|BL_ORD_ID|13796</Hit_id>
783     <Hit_def>pdb|2FUE|A protein</Hit_def>
784     <Hit_accession>13796</Hit_accession>
785     <Hit_len>262</Hit_len>
786     <Hit_hsps>
787     <Hsp>
788     <Hsp_num>1</Hsp_num>
789     <Hsp_bit-score>29.3975</Hsp_bit-score>
790     <Hsp_score>65</Hsp_score>
791     <Hsp_evalue>0.911911</Hsp_evalue>
792     <Hsp_query-from>125</Hsp_query-from>
793     <Hsp_query-to>260</Hsp_query-to>
794     <Hsp_hit-from>126</Hsp_hit-from>
795     <Hsp_hit-to>256</Hsp_hit-to>
796     <Hsp_query-frame>1</Hsp_query-frame>
797     <Hsp_hit-frame>1</Hsp_hit-frame>
798     <Hsp_identity>22</Hsp_identity>
799     <Hsp_positive>36</Hsp_positive>
800     <Hsp_gaps>5</Hsp_gaps>
801     <Hsp_align-len>136</Hsp_align-len>
802     <Hsp_qseq>AYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLL</Hsp_qseq>
803     <Hsp_hseq>GTFIEFRNGXLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSR----GGXISFDVFPEGWDKRYCLDSLDQDSFDTI-HFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFP</Hsp_hseq>
804     <Hsp_midline> + +G L P + +I +L R K ++ E+ R ISF V +G + + D I FGN S + + + IF </Hsp_midline>
805     </Hsp>
806     </Hit_hsps>
807     </Hit>
808     <Hit>
809     <Hit_num>29</Hit_num>
810     <Hit_id>gnl|BL_ORD_ID|11588</Hit_id>
811     <Hit_def>pdb|2C2A|A protein</Hit_def>
812     <Hit_accession>11588</Hit_accession>
813     <Hit_len>258</Hit_len>
814     <Hit_hsps>
815     <Hsp>
816     <Hsp_num>1</Hsp_num>
817     <Hsp_bit-score>29.0123</Hsp_bit-score>
818     <Hsp_score>64</Hsp_score>
819     <Hsp_evalue>1.29463</Hsp_evalue>
820     <Hsp_query-from>26</Hsp_query-from>
821     <Hsp_query-to>69</Hsp_query-to>
822     <Hsp_hit-from>137</Hsp_hit-from>
823     <Hsp_hit-to>186</Hsp_hit-to>
824     <Hsp_query-frame>1</Hsp_query-frame>
825     <Hsp_hit-frame>1</Hsp_hit-frame>
826     <Hsp_identity>16</Hsp_identity>
827     <Hsp_positive>27</Hsp_positive>
828     <Hsp_gaps>8</Hsp_gaps>
829     <Hsp_align-len>51</Hsp_align-len>
830     <Hsp_qseq>QRPANAIKEMIENCL-----DAKSTSIQVIV--KEGGLKLIQIQDNGTGIR</Hsp_qseq>
831     <Hsp_hseq>TRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGV-LIIVEDNGIGIP</Hsp_hseq>
832     <Hsp_midline> R + ++ N + DA ++VI+ K+GG+ LI ++DNG GI </Hsp_midline>
833     </Hsp>
834     </Hit_hsps>
835     </Hit>
836     <Hit>
837     <Hit_num>30</Hit_num>
838     <Hit_id>gnl|BL_ORD_ID|11239</Hit_id>
839     <Hit_def>pdb|2B9S|A protein</Hit_def>
840     <Hit_accession>11239</Hit_accession>
841     <Hit_len>432</Hit_len>
842     <Hit_hsps>
843     <Hsp>
844     <Hsp_num>1</Hsp_num>
845     <Hsp_bit-score>28.2419</Hsp_bit-score>
846     <Hsp_score>62</Hsp_score>
847     <Hsp_evalue>2.42058</Hsp_evalue>
848     <Hsp_query-from>119</Hsp_query-from>
849     <Hsp_query-to>186</Hsp_query-to>
850     <Hsp_hit-from>34</Hsp_hit-from>
851     <Hsp_hit-to>102</Hsp_hit-to>
852     <Hsp_query-frame>1</Hsp_query-frame>
853     <Hsp_hit-frame>1</Hsp_hit-frame>
854     <Hsp_identity>10</Hsp_identity>
855     <Hsp_positive>19</Hsp_positive>
856     <Hsp_gaps>5</Hsp_gaps>
857     <Hsp_align-len>71</Hsp_align-len>
858     <Hsp_qseq>TADGKCAYRASYSDG--KLKAPPKPCAGNQGTQITVEDLFYNIAT-RRKALKNPSEEYGKILEVVGRYSVH</Hsp_qseq>
859     <Hsp_hseq>PEYEPHGIPIFYDGREFKMTPEEEEVATM--FAVMKEHDYYRMEVFRRNFFESWREILDKRQHPIRRLELC</Hsp_hseq>
860     <Hsp_midline> Y K+ + A + E +Y + RR ++ E K + R + </Hsp_midline>
861     </Hsp>
862     </Hit_hsps>
863     </Hit>
864     <Hit>
865     <Hit_num>31</Hit_num>
866     <Hit_id>gnl|BL_ORD_ID|2030</Hit_id>
867     <Hit_def>pdb|1FRB|A protein</Hit_def>
868     <Hit_accession>2030</Hit_accession>
869     <Hit_len>315</Hit_len>
870     <Hit_hsps>
871     <Hsp>
872     <Hsp_num>1</Hsp_num>
873     <Hsp_bit-score>27.8567</Hsp_bit-score>
874     <Hsp_score>61</Hsp_score>
875     <Hsp_evalue>2.63121</Hsp_evalue>
876     <Hsp_query-from>27</Hsp_query-from>
877     <Hsp_query-to>48</Hsp_query-to>
878     <Hsp_hit-from>22</Hsp_hit-from>
879     <Hsp_hit-to>43</Hsp_hit-to>
880     <Hsp_query-frame>1</Hsp_query-frame>
881     <Hsp_hit-frame>1</Hsp_hit-frame>
882     <Hsp_identity>7</Hsp_identity>
883     <Hsp_positive>11</Hsp_positive>
884     <Hsp_align-len>22</Hsp_align-len>
885     <Hsp_qseq>RPANAIKEMIENCLDAKSTSIQ</Hsp_qseq>
886     <Hsp_hseq>SPPNQVKEAVKAAIDAGYRHID</Hsp_hseq>
887     <Hsp_midline> P N +KE ++ +DA I </Hsp_midline>
888     </Hsp>
889     </Hit_hsps>
890     </Hit>
891     <Hit>
892     <Hit_num>32</Hit_num>
893     <Hit_id>gnl|BL_ORD_ID|12828</Hit_id>
894     <Hit_def>pdb|2E5W|A B C D protein</Hit_def>
895     <Hit_accession>12828</Hit_accession>
896     <Hit_len>280</Hit_len>
897     <Hit_hsps>
898     <Hsp>
899     <Hsp_num>1</Hsp_num>
900     <Hsp_bit-score>27.4715</Hsp_bit-score>
901     <Hsp_score>60</Hsp_score>
902     <Hsp_evalue>3.2415</Hsp_evalue>
903     <Hsp_query-from>259</Hsp_query-from>
904     <Hsp_query-to>326</Hsp_query-to>
905     <Hsp_hit-from>199</Hsp_hit-from>
906     <Hsp_hit-to>280</Hsp_hit-to>
907     <Hsp_query-frame>1</Hsp_query-frame>
908     <Hsp_hit-frame>1</Hsp_hit-frame>
909     <Hsp_identity>17</Hsp_identity>
910     <Hsp_positive>30</Hsp_positive>
911     <Hsp_gaps>22</Hsp_gaps>
912     <Hsp_align-len>86</Hsp_align-len>
913     <Hsp_qseq>LLFINHRLVESTSLRKAIETVYAAYLPKNTH--PFLYL--------SLEISPQN--------VDVNVHPTKHEVHFLHEESILERV</Hsp_qseq>
914     <Hsp_hseq>YLFTDEFLTAYRKMRKVFDKVYYYSFPVIGYASPWAFLVGVKGSIDFMKVDAEKGKKLGLEYYD----PDKHETLFQMPRYIVQML</Hsp_hseq>
915     <Hsp_midline> LF + L +RK + VY P + P+ +L +++ + D P KHE F I++ +</Hsp_midline>
916     </Hsp>
917     </Hit_hsps>
918     </Hit>
919     <Hit>
920     <Hit_num>33</Hit_num>
921     <Hit_id>gnl|BL_ORD_ID|12786</Hit_id>
922     <Hit_def>pdb|2E3N|A protein</Hit_def>
923     <Hit_accession>12786</Hit_accession>
924     <Hit_len>255</Hit_len>
925     <Hit_hsps>
926     <Hsp>
927     <Hsp_num>1</Hsp_num>
928     <Hsp_bit-score>27.4715</Hsp_bit-score>
929     <Hsp_score>60</Hsp_score>
930     <Hsp_evalue>3.43646</Hsp_evalue>
931     <Hsp_query-from>120</Hsp_query-from>
932     <Hsp_query-to>162</Hsp_query-to>
933     <Hsp_hit-from>55</Hsp_hit-from>
934     <Hsp_hit-to>99</Hsp_hit-to>
935     <Hsp_query-frame>1</Hsp_query-frame>
936     <Hsp_hit-frame>1</Hsp_hit-frame>
937     <Hsp_identity>8</Hsp_identity>
938     <Hsp_positive>13</Hsp_positive>
939     <Hsp_gaps>2</Hsp_gaps>
940     <Hsp_align-len>45</Hsp_align-len>
941     <Hsp_qseq>ADGKCAYRASYSDGKLKAPPKPCAGNQG--TQITVEDLFYNIATR</Hsp_qseq>
942     <Hsp_hseq>EGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVR</Hsp_hseq>
943     <Hsp_midline> YR + + P T V + F+N+ R</Hsp_midline>
944     </Hsp>
945     </Hit_hsps>
946     </Hit>
947     <Hit>
948     <Hit_num>34</Hit_num>
949     <Hit_id>gnl|BL_ORD_ID|3943</Hit_id>
950     <Hit_def>pdb|1KQF|A protein</Hit_def>
951     <Hit_accession>3943</Hit_accession>
952     <Hit_len>1015</Hit_len>
953     <Hit_hsps>
954     <Hsp>
955     <Hsp_num>1</Hsp_num>
956     <Hsp_bit-score>26.7011</Hsp_bit-score>
957     <Hsp_score>58</Hsp_score>
958     <Hsp_evalue>6.06066</Hsp_evalue>
959     <Hsp_query-from>19</Hsp_query-from>
960     <Hsp_query-to>64</Hsp_query-to>
961     <Hsp_hit-from>275</Hsp_hit-from>
962     <Hsp_hit-to>315</Hsp_hit-to>
963     <Hsp_query-frame>1</Hsp_query-frame>
964     <Hsp_hit-frame>1</Hsp_hit-frame>
965     <Hsp_identity>10</Hsp_identity>
966     <Hsp_positive>22</Hsp_positive>
967     <Hsp_gaps>7</Hsp_gaps>
968     <Hsp_align-len>47</Hsp_align-len>
969     <Hsp_qseq>IAAGEVIQRPANAIKEMIENC-LDAKSTSIQVIVKEGGLKLIQIQDN</Hsp_qseq>
970     <Hsp_hseq>IRSGTDITFLSGVLRYLIENNKINAEY------VKHYTNASLLVRDD</Hsp_hseq>
971     <Hsp_midline>I +G I + ++ +IEN ++A+ VK + ++D+</Hsp_midline>
972     </Hsp>
973     </Hit_hsps>
974     </Hit>
975     <Hit>
976     <Hit_num>35</Hit_num>
977     <Hit_id>gnl|BL_ORD_ID|2889</Hit_id>
978     <Hit_def>pdb|1I58|A B protein</Hit_def>
979     <Hit_accession>2889</Hit_accession>
980     <Hit_len>189</Hit_len>
981     <Hit_hsps>
982     <Hsp>
983     <Hsp_num>1</Hsp_num>
984     <Hsp_bit-score>26.7011</Hsp_bit-score>
985     <Hsp_score>58</Hsp_score>
986     <Hsp_evalue>6.98428</Hsp_evalue>
987     <Hsp_query-from>59</Hsp_query-from>
988     <Hsp_query-to>71</Hsp_query-to>
989     <Hsp_hit-from>94</Hsp_hit-from>
990     <Hsp_hit-to>106</Hsp_hit-to>
991     <Hsp_query-frame>1</Hsp_query-frame>
992     <Hsp_hit-frame>1</Hsp_hit-frame>
993     <Hsp_identity>7</Hsp_identity>
994     <Hsp_positive>11</Hsp_positive>
995     <Hsp_align-len>13</Hsp_align-len>
996     <Hsp_qseq>IQIQDNGTGIRKE</Hsp_qseq>
997     <Hsp_hseq>IEVEDDGRGIDKE</Hsp_hseq>
998     <Hsp_midline>I+++D+G GI KE</Hsp_midline>
999     </Hsp>
1000     </Hit_hsps>
1001     </Hit>
1002     <Hit>
1003     <Hit_num>36</Hit_num>
1004     <Hit_id>gnl|BL_ORD_ID|7642</Hit_id>
1005     <Hit_def>pdb|1U3D|A protein</Hit_def>
1006     <Hit_accession>7642</Hit_accession>
1007     <Hit_len>509</Hit_len>
1008     <Hit_hsps>
1009     <Hsp>
1010     <Hsp_num>1</Hsp_num>
1011     <Hsp_bit-score>26.3159</Hsp_bit-score>
1012     <Hsp_score>57</Hsp_score>
1013     <Hsp_evalue>7.71979</Hsp_evalue>
1014     <Hsp_query-from>222</Hsp_query-from>
1015     <Hsp_query-to>289</Hsp_query-to>
1016     <Hsp_hit-from>188</Hsp_hit-from>
1017     <Hsp_hit-to>255</Hsp_hit-to>
1018     <Hsp_query-frame>1</Hsp_query-frame>
1019     <Hsp_hit-frame>1</Hsp_hit-frame>
1020     <Hsp_identity>9</Hsp_identity>
1021     <Hsp_positive>26</Hsp_positive>
1022     <Hsp_align-len>68</Hsp_align-len>
1023     <Hsp_qseq>NAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTH</Hsp_qseq>
1024     <Hsp_hseq>SKCVADPLVFEDDSEKGSNALLARAWSPGWSNGDKALTTFINGPLLEYSKNRRKADSATTSFLSPHLH</Hsp_hseq>
1025     <Hsp_midline>+ + + + + + + + +S FIN L+E + R+ ++ ++L + H</Hsp_midline>
1026     </Hsp>
1027     </Hit_hsps>
1028     </Hit>
1029     <Hit>
1030     <Hit_num>37</Hit_num>
1031     <Hit_id>gnl|BL_ORD_ID|374</Hit_id>
1032     <Hit_def>pdb|1B3Q|A B protein</Hit_def>
1033     <Hit_accession>374</Hit_accession>
1034     <Hit_len>379</Hit_len>
1035     <Hit_hsps>
1036     <Hsp>
1037     <Hsp_num>1</Hsp_num>
1038     <Hsp_bit-score>26.3159</Hsp_bit-score>
1039     <Hsp_score>57</Hsp_score>
1040     <Hsp_evalue>8.04866</Hsp_evalue>
1041     <Hsp_query-from>59</Hsp_query-from>
1042     <Hsp_query-to>71</Hsp_query-to>
1043     <Hsp_hit-from>153</Hsp_hit-from>
1044     <Hsp_hit-to>165</Hsp_hit-to>
1045     <Hsp_query-frame>1</Hsp_query-frame>
1046     <Hsp_hit-frame>1</Hsp_hit-frame>
1047     <Hsp_identity>7</Hsp_identity>
1048     <Hsp_positive>11</Hsp_positive>
1049     <Hsp_align-len>13</Hsp_align-len>
1050     <Hsp_qseq>IQIQDNGTGIRKE</Hsp_qseq>
1051     <Hsp_hseq>IEVEDDGRGIDKE</Hsp_hseq>
1052     <Hsp_midline>I+++D+G GI KE</Hsp_midline>
1053     </Hsp>
1054     </Hit_hsps>
1055     </Hit>
1056     <Hit>
1057     <Hit_num>38</Hit_num>
1058     <Hit_id>gnl|BL_ORD_ID|11760</Hit_id>
1059     <Hit_def>pdb|2CH4|A B protein</Hit_def>
1060     <Hit_accession>11760</Hit_accession>
1061     <Hit_len>320</Hit_len>
1062     <Hit_hsps>
1063     <Hsp>
1064     <Hsp_num>1</Hsp_num>
1065     <Hsp_bit-score>26.3159</Hsp_bit-score>
1066     <Hsp_score>57</Hsp_score>
1067     <Hsp_evalue>8.04866</Hsp_evalue>
1068     <Hsp_query-from>59</Hsp_query-from>
1069     <Hsp_query-to>71</Hsp_query-to>
1070     <Hsp_hit-from>94</Hsp_hit-from>
1071     <Hsp_hit-to>106</Hsp_hit-to>
1072     <Hsp_query-frame>1</Hsp_query-frame>
1073     <Hsp_hit-frame>1</Hsp_hit-frame>
1074     <Hsp_identity>7</Hsp_identity>
1075     <Hsp_positive>11</Hsp_positive>
1076     <Hsp_align-len>13</Hsp_align-len>
1077     <Hsp_qseq>IQIQDNGTGIRKE</Hsp_qseq>
1078     <Hsp_hseq>IEVEDDGRGIDKE</Hsp_hseq>
1079     <Hsp_midline>I+++D+G GI KE</Hsp_midline>
1080     </Hsp>
1081     </Hit_hsps>
1082     </Hit>
1083     </Iteration_hits>
1084     <Iteration_stat>
1085     <Statistics>
1086     <Statistics_db-num>20430</Statistics_db-num>
1087     <Statistics_db-len>4636376</Statistics_db-len>
1088     <Statistics_hsp-len>92</Statistics_hsp-len>
1089     <Statistics_eff-space>6.8369e+08</Statistics_eff-space>
1090     <Statistics_kappa>0.0488661</Statistics_kappa>
1091     <Statistics_lambda>0.267</Statistics_lambda>
1092     <Statistics_entropy>0.14</Statistics_entropy>
1093     </Statistics>
1094     </Iteration_stat>
1095     </Iteration>
1096     </BlastOutput_iterations>
1097     </BlastOutput>