ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/modelit/server/results/MLH1_WT_1-340/MLH1_WT_1-340.pdb-psiblast.out
Revision: 1299
Committed: Tue Jan 11 17:38:33 2011 UTC (8 years, 8 months ago) by hstehr
File size: 59972 byte(s)
Log Message:
adding Model-It server files to repository
Line File contents
1 <?xml version="1.0"?>
2 <!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
3 <BlastOutput>
4 <BlastOutput_program>blastp</BlastOutput_program>
5 <BlastOutput_version>blastp 2.2.18 [Mar-02-2008]</BlastOutput_version>
6 <BlastOutput_reference>~Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, ~Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), ~&quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search~programs&quot;, Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
7 <BlastOutput_db>/project/StruPPi/CASP8/blast_dbs/seqs_pdbase_20080903.fix.reps.fa</BlastOutput_db>
8 <BlastOutput_query-ID>lcl|QUERY</BlastOutput_query-ID>
9 <BlastOutput_query-def>MLH1_HUMAN P40692 DNA mismatch repair protein Mlh1 OS=Homo sapiens GN=MLH1 PE=1 SV=1</BlastOutput_query-def>
10 <BlastOutput_query-len>340</BlastOutput_query-len>
11 <BlastOutput_param>
12 <Parameters>
13 <Parameters_matrix>BLOSUM62</Parameters_matrix>
14 <Parameters_expect>10</Parameters_expect>
15 <Parameters_gap-open>11</Parameters_gap-open>
16 <Parameters_gap-extend>1</Parameters_gap-extend>
17 <Parameters_filter>F</Parameters_filter>
18 </Parameters>
19 </BlastOutput_param>
20 <BlastOutput_iterations>
21 <Iteration>
22 <Iteration_iter-num>1</Iteration_iter-num>
23 <Iteration_hits>
24 <Hit>
25 <Hit_num>1</Hit_num>
26 <Hit_id>gnl|BL_ORD_ID|399</Hit_id>
27 <Hit_def>pdb|1B63|A protein</Hit_def>
28 <Hit_accession>399</Hit_accession>
29 <Hit_len>333</Hit_len>
30 <Hit_hsps>
31 <Hsp>
32 <Hsp_num>1</Hsp_num>
33 <Hsp_bit-score>420.375</Hsp_bit-score>
34 <Hsp_score>1080</Hsp_score>
35 <Hsp_evalue>2.13404e-118</Hsp_evalue>
36 <Hsp_query-from>8</Hsp_query-from>
37 <Hsp_query-to>335</Hsp_query-to>
38 <Hsp_hit-from>5</Hsp_hit-from>
39 <Hsp_hit-to>333</Hsp_hit-to>
40 <Hsp_query-frame>1</Hsp_query-frame>
41 <Hsp_hit-frame>1</Hsp_hit-frame>
42 <Hsp_identity>116</Hsp_identity>
43 <Hsp_positive>179</Hsp_positive>
44 <Hsp_gaps>1</Hsp_gaps>
45 <Hsp_align-len>329</Hsp_align-len>
46 <Hsp_qseq>IRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVD-NIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLL</Hsp_qseq>
47 <Hsp_hseq>IQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALARHATSKIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQAYAEGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQGVLSVLQ</Hsp_hseq>
48 <Hsp_midline>I+ L + N+IAAGEV++RPA+ +KE++EN LDA +T I + ++ GG KLI+I+DNG GI+K++L + R TSK+ S +DL +I + GFRGEALASIS V+ +T+T++TA+ + A++A + KP A GT + V DLFYN RRK L+ E+ I E++ R ++ ++ ++ G+ V R +P + + +I G A + + I + L + N I ++N R++ + AI L + P L LEI P VDVNVHP KHEV F + + + Q + S L </Hsp_midline>
49 </Hsp>
50 </Hit_hsps>
51 </Hit>
52 <Hit>
53 <Hit_num>2</Hit_num>
54 <Hit_id>gnl|BL_ORD_ID|2567</Hit_id>
55 <Hit_def>pdb|1H7S|A B protein</Hit_def>
56 <Hit_accession>2567</Hit_accession>
57 <Hit_len>365</Hit_len>
58 <Hit_hsps>
59 <Hsp>
60 <Hsp_num>1</Hsp_num>
61 <Hsp_bit-score>353.736</Hsp_bit-score>
62 <Hsp_score>907</Hsp_score>
63 <Hsp_evalue>1.99116e-98</Hsp_evalue>
64 <Hsp_query-from>2</Hsp_query-from>
65 <Hsp_query-to>330</Hsp_query-to>
66 <Hsp_hit-from>9</Hsp_hit-from>
67 <Hsp_hit-to>359</Hsp_hit-to>
68 <Hsp_query-frame>1</Hsp_query-frame>
69 <Hsp_hit-frame>1</Hsp_hit-frame>
70 <Hsp_identity>102</Hsp_identity>
71 <Hsp_positive>180</Hsp_positive>
72 <Hsp_gaps>24</Hsp_gaps>
73 <Hsp_align-len>352</Hsp_align-len>
74 <Hsp_qseq>SFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRK-ALKNPSEEYGKILEVVGRYSVHNAGISFSVKK---QGETVADVRTLPNASTVDNIRSIFGNAVSRELIEI----------------GCEDKTLAFKMNGYISNANYSVKK---CIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHI</Hsp_qseq>
75 <Hsp_hseq>TEPAKAIKPIDRKSVHQICSGQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFADLTQVETFGFRGEALSSLCALSDVTISTCHASAKVGTRLXFDHNGKIIQKTPYPRPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKXVQVLHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENIGSVFGQKQLQSLIPFVQLPPSDSVCEEYGLSCSDALHNLFYISGFISQCTHGVGRSSTDRQFFFINRRPCDPAKVCRLVNEVYHXY-NRHQYPFVVLNISVDSECVDINVTPDKRQILLQEEKLLLAVLKTSL</Hsp_hseq>
76 <Hsp_midline>+ A I+ +D V++I +G+V+ + A+KE++EN LDA +T+I + +K+ G+ LI++ DNG G+ +E+ + + + TSK+Q F DL + T+GFRGEAL+S+ ++ VTI+T A K R + P +GT ++V+ LF + R K +N +EY K ++V+ Y + +AGI S QG+ V T + S +NI S+FG + LI + F ++G+IS + V + FIN R + + + + VY Y ++ +PF+ L++ + + VD+NV P K ++ E+ +L ++ +</Hsp_midline>
77 </Hsp>
78 </Hit_hsps>
79 </Hit>
80 <Hit>
81 <Hit_num>3</Hit_num>
82 <Hit_id>gnl|BL_ORD_ID|6742</Hit_id>
83 <Hit_def>pdb|1S16|A B protein</Hit_def>
84 <Hit_accession>6742</Hit_accession>
85 <Hit_len>390</Hit_len>
86 <Hit_hsps>
87 <Hsp>
88 <Hsp_num>1</Hsp_num>
89 <Hsp_bit-score>188.1</Hsp_bit-score>
90 <Hsp_score>477</Hsp_score>
91 <Hsp_evalue>1.59934e-48</Hsp_evalue>
92 <Hsp_query-from>2</Hsp_query-from>
93 <Hsp_query-to>284</Hsp_query-to>
94 <Hsp_hit-from>4</Hsp_hit-from>
95 <Hsp_hit-to>295</Hsp_hit-to>
96 <Hsp_query-frame>1</Hsp_query-frame>
97 <Hsp_hit-frame>1</Hsp_hit-frame>
98 <Hsp_identity>39</Hsp_identity>
99 <Hsp_positive>90</Hsp_positive>
100 <Hsp_gaps>31</Hsp_gaps>
101 <Hsp_align-len>303</Hsp_align-len>
102 <Hsp_qseq>SFVAGVIRRLDETVVNRIAAGEVI--QRPANAIKEMIENCLD----AKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLD---------IVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRL-----VESTSLRKAIETVYAAYL</Hsp_qseq>
103 <Hsp_hseq>TYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHAD--QSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGK---FSNKNYQFSGGLHGVGISVVNALSKRVEVNVRRDGQV-YNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPD---ETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQDGLNDYLAEAVNGLPTLPEKPFIGNFAGDTEAVDWALLWLPEGGE--LLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFC</Hsp_hseq>
104 <Hsp_midline>++ A I L R G RP + +E+I+N +D + + VI+ + +++ D+G G+ + I+C K F + + G G ++ ++ ++ DG+ Y ++ +G+ + F+ +P ++ V+ +V G+ + K + + ++ G E IG + + ++N LR+ + + </Hsp_midline>
105 </Hsp>
106 </Hit_hsps>
107 </Hit>
108 <Hit>
109 <Hit_num>4</Hit_num>
110 <Hit_id>gnl|BL_ORD_ID|1540</Hit_id>
111 <Hit_def>pdb|1EI1|A B protein</Hit_def>
112 <Hit_accession>1540</Hit_accession>
113 <Hit_len>391</Hit_len>
114 <Hit_hsps>
115 <Hsp>
116 <Hsp_num>1</Hsp_num>
117 <Hsp_bit-score>169.995</Hsp_bit-score>
118 <Hsp_score>430</Hsp_score>
119 <Hsp_evalue>4.85864e-43</Hsp_evalue>
120 <Hsp_query-from>8</Hsp_query-from>
121 <Hsp_query-to>285</Hsp_query-to>
122 <Hsp_hit-from>9</Hsp_hit-from>
123 <Hsp_hit-to>293</Hsp_hit-to>
124 <Hsp_query-frame>1</Hsp_query-frame>
125 <Hsp_hit-frame>1</Hsp_hit-frame>
126 <Hsp_identity>41</Hsp_identity>
127 <Hsp_positive>86</Hsp_positive>
128 <Hsp_gaps>35</Hsp_gaps>
129 <Hsp_align-len>299</Hsp_align-len>
130 <Hsp_qseq>IRRLDETVVNRIAAGEVI------QRPANAIKEMIENCLD---AKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLD---------IVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKK--QGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKA-IETVYAAYLP</Hsp_qseq>
131 <Hsp_hseq>IKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCK-EIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGK---FDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQI-YEHGVPQAPLAVTGETEKTGTMVRF----WPSLETFTNVTEFEYEILAKRLRELSFLDSGVSIRLRDKRDGKED-HFHYEGGIKAFVEYLNKNKTPIHPNIFYFSTEKDGIGVEV----ALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLN</Hsp_hseq>
132 <Hsp_midline>I+ L R G I + + E+++N +D A ++IV + +QD+G GI I+ K F+D + + G G ++ ++ ++ +GK + Y G +AP + T V + EY + + + S ++G+S ++ G+ + + + E + ++ + + F N+ A L </Hsp_midline>
133 </Hsp>
134 </Hit_hsps>
135 </Hit>
136 <Hit>
137 <Hit_num>5</Hit_num>
138 <Hit_id>gnl|BL_ORD_ID|189</Hit_id>
139 <Hit_def>pdb|1AJ6|A protein</Hit_def>
140 <Hit_accession>189</Hit_accession>
141 <Hit_len>219</Hit_len>
142 <Hit_hsps>
143 <Hsp>
144 <Hsp_num>1</Hsp_num>
145 <Hsp_bit-score>145.728</Hsp_bit-score>
146 <Hsp_score>367</Hsp_score>
147 <Hsp_evalue>9.65017e-36</Hsp_evalue>
148 <Hsp_query-from>2</Hsp_query-from>
149 <Hsp_query-to>209</Hsp_query-to>
150 <Hsp_hit-from>3</Hsp_hit-from>
151 <Hsp_hit-to>219</Hsp_hit-to>
152 <Hsp_query-frame>1</Hsp_query-frame>
153 <Hsp_hit-frame>1</Hsp_hit-frame>
154 <Hsp_identity>38</Hsp_identity>
155 <Hsp_positive>76</Hsp_positive>
156 <Hsp_gaps>27</Hsp_gaps>
157 <Hsp_align-len>226</Hsp_align-len>
158 <Hsp_qseq>SFVAGVIRRLDETVVNRIAAGEVI------QRPANAIKEMIENCLD---AKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLD---------IVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPN</Hsp_qseq>
159 <Hsp_hseq>SYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCK-EIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGK---FDDNSYKVSGGLHGVGVSVVNALSQKLELVIQHEGKIHRQI-YEHGVPQAPLAVTGETEKTGTMVRF----WPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEG</Hsp_hseq>
160 <Hsp_midline>S+ + I+ L R G I + + E+++N +D A ++IV + +QD+G GI I+ K F+D + + G G ++ ++ ++ +GK + Y G +AP + T V + EY + + + S N+G+S ++ + + D </Hsp_midline>
161 </Hsp>
162 </Hit_hsps>
163 </Hit>
164 <Hit>
165 <Hit_num>6</Hit_num>
166 <Hit_id>gnl|BL_ORD_ID|3865</Hit_id>
167 <Hit_def>pdb|1KIJ|A B protein</Hit_def>
168 <Hit_accession>3865</Hit_accession>
169 <Hit_len>390</Hit_len>
170 <Hit_hsps>
171 <Hsp>
172 <Hsp_num>1</Hsp_num>
173 <Hsp_bit-score>128.009</Hsp_bit-score>
174 <Hsp_score>321</Hsp_score>
175 <Hsp_evalue>1.80691e-30</Hsp_evalue>
176 <Hsp_query-from>1</Hsp_query-from>
177 <Hsp_query-to>285</Hsp_query-to>
178 <Hsp_hit-from>1</Hsp_hit-from>
179 <Hsp_hit-to>292</Hsp_hit-to>
180 <Hsp_query-frame>1</Hsp_query-frame>
181 <Hsp_hit-frame>1</Hsp_hit-frame>
182 <Hsp_identity>52</Hsp_identity>
183 <Hsp_positive>98</Hsp_positive>
184 <Hsp_gaps>37</Hsp_gaps>
185 <Hsp_align-len>307</Hsp_align-len>
186 <Hsp_qseq>MSFVAGVIRRLDETVVNRIAAGEVI-----QRPANAIKEMIENCLD---AK-STSIQVIVKEGGLKLIQIQDNGTGIRKEDLD---IVCERFTTSKLQSFEDLA---SISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGIS--FSVKKQGETVADVRTLPNASTVDNIRS----IFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLR-KAIETVYAAYLP</Hsp_qseq>
187 <Hsp_hseq>MSYDASAIRVLKGLEGVRHRPAMYIGGTGVEGYHHLFKEILDNAVDEALAGYATEILVRLNEDG--SLTVEDNGRGIPVDLMPEEGKPAVEVIYNTLHSGGKFEQGAYKVSGGLHGVGASVVNALSEWTVVEVFREGKHH-RIAFSRGEVTEPLRVVGEAPRGKTGTRVTFKPDP---EIFGNLRFDPSKIRARLREVAYLVAGLKLVFQDRQHGKEEVFLDKGGVASFAKALAEGEDLLYEKPFLIRGTHGEVEVEVGFLHTQGY---------NAEILTYANMIPTRDGGTHLTAFKSAYSRALN</Hsp_hseq>
188 <Hsp_midline>MS+ A IR L R I + + KE+++N +D A +T I V + E G + ++DNG GI + + + L S + G G + ++ ++ T+ +GK R ++S G++ P + + F + N + KI + + AG+ F ++ G+ + AS + ++ E + GY L + N A ++ Y+ L </Hsp_midline>
189 </Hsp>
190 </Hit_hsps>
191 </Hit>
192 <Hit>
193 <Hit_num>7</Hit_num>
194 <Hit_id>gnl|BL_ORD_ID|6741</Hit_id>
195 <Hit_def>pdb|1S14|A B protein</Hit_def>
196 <Hit_accession>6741</Hit_accession>
197 <Hit_len>194</Hit_len>
198 <Hit_hsps>
199 <Hsp>
200 <Hsp_num>1</Hsp_num>
201 <Hsp_bit-score>119.149</Hsp_bit-score>
202 <Hsp_score>298</Hsp_score>
203 <Hsp_evalue>9.43346e-28</Hsp_evalue>
204 <Hsp_query-from>2</Hsp_query-from>
205 <Hsp_query-to>209</Hsp_query-to>
206 <Hsp_hit-from>4</Hsp_hit-from>
207 <Hsp_hit-to>194</Hsp_hit-to>
208 <Hsp_query-frame>1</Hsp_query-frame>
209 <Hsp_hit-frame>1</Hsp_hit-frame>
210 <Hsp_identity>26</Hsp_identity>
211 <Hsp_positive>66</Hsp_positive>
212 <Hsp_gaps>35</Hsp_gaps>
213 <Hsp_align-len>217</Hsp_align-len>
214 <Hsp_qseq>SFVAGVIRRLDETVVNRIAAGEVI--QRPANAIKEMIENCLD----AKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLD---IVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPN</Hsp_qseq>
215 <Hsp_hseq>TYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHAD--QSLEVIDDGRGMPVDIHPEEGVPAVELILC--------------------ISVVNALSKRVEVNVRRDGQV-YNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPD---ETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQD</Hsp_hseq>
216 <Hsp_midline>++ A I L R G RP + +E+I+N +D + + VI+ + +++ D+G G+ + + ++ ++ ++ DG+ Y ++ +G+ + F+ +P ++ V+ +V G+ + K + +</Hsp_midline>
217 </Hsp>
218 </Hit_hsps>
219 </Hit>
220 <Hit>
221 <Hit_num>8</Hit_num>
222 <Hit_id>gnl|BL_ORD_ID|17211</Hit_id>
223 <Hit_def>pdb|2Q2E|B protein</Hit_def>
224 <Hit_accession>17211</Hit_accession>
225 <Hit_len>621</Hit_len>
226 <Hit_hsps>
227 <Hsp>
228 <Hsp_num>1</Hsp_num>
229 <Hsp_bit-score>59.0579</Hsp_bit-score>
230 <Hsp_score>142</Hsp_score>
231 <Hsp_evalue>1.18789e-09</Hsp_evalue>
232 <Hsp_query-from>27</Hsp_query-from>
233 <Hsp_query-to>209</Hsp_query-to>
234 <Hsp_hit-from>37</Hsp_hit-from>
235 <Hsp_hit-to>225</Hsp_hit-to>
236 <Hsp_query-frame>1</Hsp_query-frame>
237 <Hsp_hit-frame>1</Hsp_hit-frame>
238 <Hsp_identity>37</Hsp_identity>
239 <Hsp_positive>69</Hsp_positive>
240 <Hsp_gaps>36</Hsp_gaps>
241 <Hsp_align-len>204</Hsp_align-len>
242 <Hsp_qseq>RPANAIKEMIENCLDAKSTS-----IQVIVKEGGLKLIQIQ--DNGTGIRKEDLDIVCER-FTTSKLQSFEDLASISTYGFRGEALASISHVAHVT------ITTKTADGKCAYRASY-------SDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPN</Hsp_qseq>
243 <Hsp_hseq>SLITTVKEAVDNALDACEEAGILPDILVQVERTGPDYVTVIIEDNGPGIVREQIPKVFAKLLYGSRFHAL-----KQSRGQQGIGISAAVLYAQMTAGRHTKILSKTSPTAPAHYYELMINTSTNEPDILVDEVRDWFRPHGTQIELEMRAAYVKGRRQS----------IYEYLKATAIVNPHARITLIDPDGNEEVFERATD</Hsp_hseq>
244 <Hsp_midline> +KE ++N LDA + I V V+ G + + DNG GI +E + V + S+ + + G +G +++ A +T I +KT+ A+ L + GTQI +E + RR++ I E + ++ N ++ +</Hsp_midline>
245 </Hsp>
246 </Hit_hsps>
247 </Hit>
248 <Hit>
249 <Hit_num>9</Hit_num>
250 <Hit_id>gnl|BL_ORD_ID|4654</Hit_id>
251 <Hit_def>pdb|1MU5|A protein</Hit_def>
252 <Hit_accession>4654</Hit_accession>
253 <Hit_len>471</Hit_len>
254 <Hit_hsps>
255 <Hsp>
256 <Hsp_num>1</Hsp_num>
257 <Hsp_bit-score>54.8207</Hsp_bit-score>
258 <Hsp_score>131</Hsp_score>
259 <Hsp_evalue>2.29705e-08</Hsp_evalue>
260 <Hsp_query-from>28</Hsp_query-from>
261 <Hsp_query-to>196</Hsp_query-to>
262 <Hsp_hit-from>33</Hsp_hit-from>
263 <Hsp_hit-to>208</Hsp_hit-to>
264 <Hsp_query-frame>1</Hsp_query-frame>
265 <Hsp_hit-frame>1</Hsp_hit-frame>
266 <Hsp_identity>33</Hsp_identity>
267 <Hsp_positive>63</Hsp_positive>
268 <Hsp_gaps>45</Hsp_gaps>
269 <Hsp_align-len>195</Hsp_align-len>
270 <Hsp_qseq>PANAIKEMIENCLDAKST---------SIQVIVKEGGLK--LIQIQDNGTGIRKEDLDIVCER-FTTSKLQSFEDLASISTYGFRGEALASISHVAHV------TITTKTADGKCAY----RASYSDGKLK----APPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKK</Hsp_qseq>
271 <Hsp_hseq>LYQTVRELIENSLDA--TDVHGILPNIKITIDLIDDARQIYKVNVVDNGIGIPPQEVPNAFGRVLYSSKY------VNRQTRGMYGLGVKAAVLYSQMHQDKPIEIETSPVNSKRIYTFKLKIDINKNEPIIVERGSVENTRGFHGTSVAIS-----IPG------DWPKAKSRIYEYIKRTYIITPYAEFIFKD</Hsp_hseq>
272 <Hsp_midline> ++E+IEN LDA T I + + + + + + DNG GI +++ R +SK + T G G + + + + I T + K Y + + + + G GT + + I + + +I E + R + F K </Hsp_midline>
273 </Hsp>
274 </Hit_hsps>
275 </Hit>
276 <Hit>
277 <Hit_num>10</Hit_num>
278 <Hit_id>gnl|BL_ORD_ID|18946</Hit_id>
279 <Hit_def>pdb|2ZBK|B D F H protein</Hit_def>
280 <Hit_accession>18946</Hit_accession>
281 <Hit_len>530</Hit_len>
282 <Hit_hsps>
283 <Hsp>
284 <Hsp_num>1</Hsp_num>
285 <Hsp_bit-score>54.4355</Hsp_bit-score>
286 <Hsp_score>130</Hsp_score>
287 <Hsp_evalue>2.95039e-08</Hsp_evalue>
288 <Hsp_query-from>28</Hsp_query-from>
289 <Hsp_query-to>196</Hsp_query-to>
290 <Hsp_hit-from>32</Hsp_hit-from>
291 <Hsp_hit-to>207</Hsp_hit-to>
292 <Hsp_query-frame>1</Hsp_query-frame>
293 <Hsp_hit-frame>1</Hsp_hit-frame>
294 <Hsp_identity>33</Hsp_identity>
295 <Hsp_positive>63</Hsp_positive>
296 <Hsp_gaps>45</Hsp_gaps>
297 <Hsp_align-len>195</Hsp_align-len>
298 <Hsp_qseq>PANAIKEMIENCLDAKST---------SIQVIVKEGGLK--LIQIQDNGTGIRKEDLDIVCER-FTTSKLQSFEDLASISTYGFRGEALASISHVAHV------TITTKTADGKCAY----RASYSDGKLK----APPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKK</Hsp_qseq>
299 <Hsp_hseq>LYQTVRELIENSLDA--TDVHGILPNIKITIDLIDDARQIYKVNVVDNGIGIPPQEVPNAFGRVLYSSKY------VNRQTRGMYGLGVKAAVLYSQMHQDKPIEIETSPVNSKRIYTFKLKIDINKNEPIIVERGSVENTRGFHGTSVAIS-----IPG------DWPKAKSRIYEYIKRTYIITPYAEFIFKD</Hsp_hseq>
300 <Hsp_midline> ++E+IEN LDA T I + + + + + + DNG GI +++ R +SK + T G G + + + + I T + K Y + + + + G GT + + I + + +I E + R + F K </Hsp_midline>
301 </Hsp>
302 </Hit_hsps>
303 </Hit>
304 <Hit>
305 <Hit_num>11</Hit_num>
306 <Hit_id>gnl|BL_ORD_ID|16138</Hit_id>
307 <Hit_def>pdb|2O1U|A B protein</Hit_def>
308 <Hit_accession>16138</Hit_accession>
309 <Hit_len>666</Hit_len>
310 <Hit_hsps>
311 <Hsp>
312 <Hsp_num>1</Hsp_num>
313 <Hsp_bit-score>45.1907</Hsp_bit-score>
314 <Hsp_score>106</Hsp_score>
315 <Hsp_evalue>1.56624e-05</Hsp_evalue>
316 <Hsp_query-from>37</Hsp_query-from>
317 <Hsp_query-to>307</Hsp_query-to>
318 <Hsp_hit-from>72</Hsp_hit-from>
319 <Hsp_hit-to>358</Hsp_hit-to>
320 <Hsp_query-frame>1</Hsp_query-frame>
321 <Hsp_hit-frame>1</Hsp_hit-frame>
322 <Hsp_identity>53</Hsp_identity>
323 <Hsp_positive>96</Hsp_positive>
324 <Hsp_gaps>66</Hsp_gaps>
325 <Hsp_align-len>312</Hsp_align-len>
326 <Hsp_qseq>ENCLDAKSTSIQVIVK-EGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSF--------EDLASISTY-GFRGEALASISHVA-HVTITTKTADGKCA-YRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS-VHNAGI---------------SFSVKKQGETVADVRTLP-NASTVDNIRSIFGNAVSRELIEIGCEDKTL-AFKMNGYIS--------NANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSL---EISPQNVDVNV</Hsp_qseq>
327 <Hsp_hseq>ENAL-AGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLV---------LKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGGGGKTVWDWELMNDIKPIWQRPSKEVEDDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDD---------FHDMMPK------YLNFVKGVVDSDDLPLNV</Hsp_hseq>
328 <Hsp_midline>EN L A + + V +K + L+ + D G G+ +E+L S F ED S S G G S VA V +T+K + + + ++ + A P+ +GT IT+ K + E I +V +YS N I + + + + + F + I + FK ++ + S K L++ + + +PK YL+ + ++ +NV</Hsp_midline>
329 </Hsp>
330 </Hit_hsps>
331 </Hit>
332 <Hit>
333 <Hit_num>12</Hit_num>
334 <Hit_id>gnl|BL_ORD_ID|16139</Hit_id>
335 <Hit_def>pdb|2O1W|A B C D E protein</Hit_def>
336 <Hit_accession>16139</Hit_accession>
337 <Hit_len>506</Hit_len>
338 <Hit_hsps>
339 <Hsp>
340 <Hsp_num>1</Hsp_num>
341 <Hsp_bit-score>45.1907</Hsp_bit-score>
342 <Hsp_score>106</Hsp_score>
343 <Hsp_evalue>1.89759e-05</Hsp_evalue>
344 <Hsp_query-from>37</Hsp_query-from>
345 <Hsp_query-to>307</Hsp_query-to>
346 <Hsp_hit-from>72</Hsp_hit-from>
347 <Hsp_hit-to>358</Hsp_hit-to>
348 <Hsp_query-frame>1</Hsp_query-frame>
349 <Hsp_hit-frame>1</Hsp_hit-frame>
350 <Hsp_identity>53</Hsp_identity>
351 <Hsp_positive>96</Hsp_positive>
352 <Hsp_gaps>66</Hsp_gaps>
353 <Hsp_align-len>312</Hsp_align-len>
354 <Hsp_qseq>ENCLDAKSTSIQVIVK-EGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSF--------EDLASISTY-GFRGEALASISHVA-HVTITTKTADGKCA-YRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS-VHNAGI---------------SFSVKKQGETVADVRTLP-NASTVDNIRSIFGNAVSRELIEIGCEDKTL-AFKMNGYIS--------NANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSL---EISPQNVDVNV</Hsp_qseq>
355 <Hsp_hseq>ENAL-AGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLV---------LKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGGGGKTVWDWELMNDIKPIWQRPSKEVEDDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDD---------FHDMMPK------YLNFVKGVVDSDDLPLNV</Hsp_hseq>
356 <Hsp_midline>EN L A + + V +K + L+ + D G G+ +E+L S F ED S S G G S VA V +T+K + + + ++ + A P+ +GT IT+ K + E I +V +YS N I + + + + + F + I + FK ++ + S K L++ + + +PK YL+ + ++ +NV</Hsp_midline>
357 </Hsp>
358 </Hit_hsps>
359 </Hit>
360 <Hit>
361 <Hit_num>13</Hit_num>
362 <Hit_id>gnl|BL_ORD_ID|14203</Hit_id>
363 <Hit_def>pdb|2GQP|A B protein</Hit_def>
364 <Hit_accession>14203</Hit_accession>
365 <Hit_len>236</Hit_len>
366 <Hit_hsps>
367 <Hsp>
368 <Hsp_num>1</Hsp_num>
369 <Hsp_bit-score>44.4203</Hsp_bit-score>
370 <Hsp_score>104</Hsp_score>
371 <Hsp_evalue>2.6274e-05</Hsp_evalue>
372 <Hsp_query-from>37</Hsp_query-from>
373 <Hsp_query-to>184</Hsp_query-to>
374 <Hsp_hit-from>59</Hsp_hit-from>
375 <Hsp_hit-to>208</Hsp_hit-to>
376 <Hsp_query-frame>1</Hsp_query-frame>
377 <Hsp_hit-frame>1</Hsp_hit-frame>
378 <Hsp_identity>38</Hsp_identity>
379 <Hsp_positive>61</Hsp_positive>
380 <Hsp_gaps>22</Hsp_gaps>
381 <Hsp_align-len>160</Hsp_align-len>
382 <Hsp_qseq>ENCLDAKSTSIQVIVK-EGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSF--------EDLASISTY-GFRGEALASISHVA-HVTITTKTADGKCA-YRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS</Hsp_qseq>
383 <Hsp_hseq>ENAL-AGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLV---------LKEEASDYLELDTIKNLVKKYS</Hsp_hseq>
384 <Hsp_midline>EN L A + + V +K + L+ + D G G+ +E+L S F ED S S G G S VA V +T+K + + + ++ + A P+ +GT IT+ K + E I +V +YS</Hsp_midline>
385 </Hsp>
386 </Hit_hsps>
387 </Hit>
388 <Hit>
389 <Hit_num>14</Hit_num>
390 <Hit_id>gnl|BL_ORD_ID|6295</Hit_id>
391 <Hit_def>pdb|1QY5|A protein</Hit_def>
392 <Hit_accession>6295</Hit_accession>
393 <Hit_len>269</Hit_len>
394 <Hit_hsps>
395 <Hsp>
396 <Hsp_num>1</Hsp_num>
397 <Hsp_bit-score>44.0351</Hsp_bit-score>
398 <Hsp_score>103</Hsp_score>
399 <Hsp_evalue>3.66836e-05</Hsp_evalue>
400 <Hsp_query-from>37</Hsp_query-from>
401 <Hsp_query-to>184</Hsp_query-to>
402 <Hsp_hit-from>55</Hsp_hit-from>
403 <Hsp_hit-to>204</Hsp_hit-to>
404 <Hsp_query-frame>1</Hsp_query-frame>
405 <Hsp_hit-frame>1</Hsp_hit-frame>
406 <Hsp_identity>38</Hsp_identity>
407 <Hsp_positive>61</Hsp_positive>
408 <Hsp_gaps>22</Hsp_gaps>
409 <Hsp_align-len>160</Hsp_align-len>
410 <Hsp_qseq>ENCLDAKSTSIQVIVK-EGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSF--------EDLASISTY-GFRGEALASISHVA-HVTITTKTADGKCA-YRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS</Hsp_qseq>
411 <Hsp_hseq>ENAL-AGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLV---------LKEEASDYLELDTIKNLVKKYS</Hsp_hseq>
412 <Hsp_midline>EN L A + + V +K + L+ + D G G+ +E+L S F ED S S G G S VA V +T+K + + + ++ + A P+ +GT IT+ K + E I +V +YS</Hsp_midline>
413 </Hsp>
414 </Hit_hsps>
415 </Hit>
416 <Hit>
417 <Hit_num>15</Hit_num>
418 <Hit_id>gnl|BL_ORD_ID|9861</Hit_id>
419 <Hit_def>pdb|1YC1|A protein</Hit_def>
420 <Hit_accession>9861</Hit_accession>
421 <Hit_len>264</Hit_len>
422 <Hit_hsps>
423 <Hsp>
424 <Hsp_num>1</Hsp_num>
425 <Hsp_bit-score>41.7239</Hsp_bit-score>
426 <Hsp_score>97</Hsp_score>
427 <Hsp_evalue>0.000206332</Hsp_evalue>
428 <Hsp_query-from>32</Hsp_query-from>
429 <Hsp_query-to>184</Hsp_query-to>
430 <Hsp_hit-from>73</Hsp_hit-from>
431 <Hsp_hit-to>239</Hsp_hit-to>
432 <Hsp_query-frame>1</Hsp_query-frame>
433 <Hsp_hit-frame>1</Hsp_hit-frame>
434 <Hsp_identity>40</Hsp_identity>
435 <Hsp_positive>59</Hsp_positive>
436 <Hsp_gaps>38</Hsp_gaps>
437 <Hsp_align-len>179</Hsp_align-len>
438 <Hsp_qseq>IKEMIENCLDAKSTSIQVIVK------EGGLKL------------IQIQDNGTGIRKEDL-------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAH-VTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS</Hsp_qseq>
439 <Hsp_hseq>LRELISNSSDA-LDKIRYETLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMI---GQFGVGFYSAYLVAEKVTVITKHNDDEQ-YAWESSAGGSFTVRTDTGEPMGRGTKVILH-------LKEDQTEYLEERRIKEIVKKHS</Hsp_hseq>
440 <Hsp_midline>++E+I N DA I+ + G +L + I D G G+ K DL + LQ+ D++ I G G S VA VT+ TK D + Y S G G V K + E +I E+V ++S</Hsp_midline>
441 </Hsp>
442 </Hit_hsps>
443 </Hit>
444 <Hit>
445 <Hit_num>16</Hit_num>
446 <Hit_id>gnl|BL_ORD_ID|8042</Hit_id>
447 <Hit_def>pdb|1UYL|A protein</Hit_def>
448 <Hit_accession>8042</Hit_accession>
449 <Hit_len>236</Hit_len>
450 <Hit_hsps>
451 <Hsp>
452 <Hsp_num>1</Hsp_num>
453 <Hsp_bit-score>40.1831</Hsp_bit-score>
454 <Hsp_score>93</Hsp_score>
455 <Hsp_evalue>0.000600333</Hsp_evalue>
456 <Hsp_query-from>32</Hsp_query-from>
457 <Hsp_query-to>184</Hsp_query-to>
458 <Hsp_hit-from>45</Hsp_hit-from>
459 <Hsp_hit-to>211</Hsp_hit-to>
460 <Hsp_query-frame>1</Hsp_query-frame>
461 <Hsp_hit-frame>1</Hsp_hit-frame>
462 <Hsp_identity>40</Hsp_identity>
463 <Hsp_positive>59</Hsp_positive>
464 <Hsp_gaps>38</Hsp_gaps>
465 <Hsp_align-len>179</Hsp_align-len>
466 <Hsp_qseq>IKEMIENCLDAKSTSIQVIVK------EGGLKL------------IQIQDNGTGIRKEDL-------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAH-VTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYS</Hsp_qseq>
467 <Hsp_hseq>LRELISNSSDA-LDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMI---GQFGVGFYSAYLVAEKVTVITKHNDDEQ-YAWESSAGGSFTVRTDTGEPMGRGTKVILH-------LKEDQTEYLEERRIKEIVKKHS</Hsp_hseq>
468 <Hsp_midline>++E+I N DA I+ + G +L + I D G G+ K DL + LQ+ D++ I G G S VA VT+ TK D + Y S G G V K + E +I E+V ++S</Hsp_midline>
469 </Hsp>
470 </Hit_hsps>
471 </Hit>
472 <Hit>
473 <Hit_num>17</Hit_num>
474 <Hit_id>gnl|BL_ORD_ID|11753</Hit_id>
475 <Hit_def>pdb|2CG9|A B protein</Hit_def>
476 <Hit_accession>11753</Hit_accession>
477 <Hit_len>677</Hit_len>
478 <Hit_hsps>
479 <Hsp>
480 <Hsp_num>1</Hsp_num>
481 <Hsp_bit-score>38.2571</Hsp_bit-score>
482 <Hsp_score>88</Hsp_score>
483 <Hsp_evalue>0.00193065</Hsp_evalue>
484 <Hsp_query-from>57</Hsp_query-from>
485 <Hsp_query-to>184</Hsp_query-to>
486 <Hsp_hit-from>73</Hsp_hit-from>
487 <Hsp_hit-to>198</Hsp_hit-to>
488 <Hsp_query-frame>1</Hsp_query-frame>
489 <Hsp_hit-frame>1</Hsp_hit-frame>
490 <Hsp_identity>31</Hsp_identity>
491 <Hsp_positive>53</Hsp_positive>
492 <Hsp_gaps>24</Hsp_gaps>
493 <Hsp_align-len>139</Hsp_align-len>
494 <Hsp_qseq>KLIQIQDNGTGIRKEDL-------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVA-HVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEY---GKILEVVGRYS</Hsp_qseq>
495 <Hsp_hseq>KVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMI---GQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTIL----------RLFLKDDQLEYLEEKRIKEVIKRHS</Hsp_hseq>
496 <Hsp_midline>K+++I+D+G G+ K +L + L + D++ I G G S+ VA V + +K+ D + S + G G + R LK+ EY +I EV+ R+S</Hsp_midline>
497 </Hsp>
498 </Hit_hsps>
499 </Hit>
500 <Hit>
501 <Hit_num>18</Hit_num>
502 <Hit_id>gnl|BL_ORD_ID|15147</Hit_id>
503 <Hit_def>pdb|2IOQ|A B protein</Hit_def>
504 <Hit_accession>15147</Hit_accession>
505 <Hit_len>624</Hit_len>
506 <Hit_hsps>
507 <Hsp>
508 <Hsp_num>1</Hsp_num>
509 <Hsp_bit-score>38.2571</Hsp_bit-score>
510 <Hsp_score>88</Hsp_score>
511 <Hsp_evalue>0.00209865</Hsp_evalue>
512 <Hsp_query-from>32</Hsp_query-from>
513 <Hsp_query-to>151</Hsp_query-to>
514 <Hsp_hit-from>32</Hsp_hit-from>
515 <Hsp_hit-to>177</Hsp_hit-to>
516 <Hsp_query-frame>1</Hsp_query-frame>
517 <Hsp_hit-frame>1</Hsp_hit-frame>
518 <Hsp_identity>29</Hsp_identity>
519 <Hsp_positive>53</Hsp_positive>
520 <Hsp_gaps>28</Hsp_gaps>
521 <Hsp_align-len>147</Hsp_align-len>
522 <Hsp_qseq>IKEMIENCLDA------------------KSTSIQVIVKEGGLKLIQIQDNGTGIRKED----LDIVCERFTTSKLQSFEDLASIST--YGFRGEALASISHVA-HVTITTKTADG--KCAYRASYSDGKLKAPPKPCAGNQGTQIT</Hsp_qseq>
523 <Hsp_hseq>LRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKD-KRTLTISDNGVGMTRDEVIDHLGTIAKSGTKSFLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEIT</Hsp_hseq>
524 <Hsp_midline>++E+I N DA ++V + + + I DNG G+ +++ L + + T S L+S + + G G S VA VT+ T+ A + + ++GT+IT</Hsp_midline>
525 </Hsp>
526 </Hit_hsps>
527 </Hit>
528 <Hit>
529 <Hit_num>19</Hit_num>
530 <Hit_id>gnl|BL_ORD_ID|9751</Hit_id>
531 <Hit_def>pdb|1Y4S|A B protein</Hit_def>
532 <Hit_accession>9751</Hit_accession>
533 <Hit_len>559</Hit_len>
534 <Hit_hsps>
535 <Hsp>
536 <Hsp_num>1</Hsp_num>
537 <Hsp_bit-score>38.2571</Hsp_bit-score>
538 <Hsp_score>88</Hsp_score>
539 <Hsp_evalue>0.00215184</Hsp_evalue>
540 <Hsp_query-from>32</Hsp_query-from>
541 <Hsp_query-to>151</Hsp_query-to>
542 <Hsp_hit-from>32</Hsp_hit-from>
543 <Hsp_hit-to>177</Hsp_hit-to>
544 <Hsp_query-frame>1</Hsp_query-frame>
545 <Hsp_hit-frame>1</Hsp_hit-frame>
546 <Hsp_identity>29</Hsp_identity>
547 <Hsp_positive>53</Hsp_positive>
548 <Hsp_gaps>28</Hsp_gaps>
549 <Hsp_align-len>147</Hsp_align-len>
550 <Hsp_qseq>IKEMIENCLDA------------------KSTSIQVIVKEGGLKLIQIQDNGTGIRKED----LDIVCERFTTSKLQSFEDLASIST--YGFRGEALASISHVA-HVTITTKTADG--KCAYRASYSDGKLKAPPKPCAGNQGTQIT</Hsp_qseq>
551 <Hsp_hseq>LRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKD-KRTLTISDNGVGMTRDEVIDHLGTIAKSGTKSFLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEIT</Hsp_hseq>
552 <Hsp_midline>++E+I N DA ++V + + + I DNG G+ +++ L + + T S L+S + + G G S VA VT+ T+ A + + ++GT+IT</Hsp_midline>
553 </Hsp>
554 </Hit_hsps>
555 </Hit>
556 <Hit>
557 <Hit_num>20</Hit_num>
558 <Hit_id>gnl|BL_ORD_ID|10917</Hit_id>
559 <Hit_def>pdb|2AKP|A B protein</Hit_def>
560 <Hit_accession>10917</Hit_accession>
561 <Hit_len>186</Hit_len>
562 <Hit_hsps>
563 <Hsp>
564 <Hsp_num>1</Hsp_num>
565 <Hsp_bit-score>37.4867</Hsp_bit-score>
566 <Hsp_score>86</Hsp_score>
567 <Hsp_evalue>0.00315862</Hsp_evalue>
568 <Hsp_query-from>57</Hsp_query-from>
569 <Hsp_query-to>184</Hsp_query-to>
570 <Hsp_hit-from>49</Hsp_hit-from>
571 <Hsp_hit-to>174</Hsp_hit-to>
572 <Hsp_query-frame>1</Hsp_query-frame>
573 <Hsp_hit-frame>1</Hsp_hit-frame>
574 <Hsp_identity>31</Hsp_identity>
575 <Hsp_positive>53</Hsp_positive>
576 <Hsp_gaps>24</Hsp_gaps>
577 <Hsp_align-len>139</Hsp_align-len>
578 <Hsp_qseq>KLIQIQDNGTGIRKEDL-------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVA-HVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEY---GKILEVVGRYS</Hsp_qseq>
579 <Hsp_hseq>KVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMI---GQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTIL----------RLFLKDDQLEYLEEKRIKEVIKRHS</Hsp_hseq>
580 <Hsp_midline>K+++I+D+G G+ K +L + L + D++ I G G S+ VA V + +K+ D + S + G G + R LK+ EY +I EV+ R+S</Hsp_midline>
581 </Hsp>
582 </Hit_hsps>
583 </Hit>
584 <Hit>
585 <Hit_num>21</Hit_num>
586 <Hit_id>gnl|BL_ORD_ID|15237</Hit_id>
587 <Hit_def>pdb|2IWX|A protein</Hit_def>
588 <Hit_accession>15237</Hit_accession>
589 <Hit_len>214</Hit_len>
590 <Hit_hsps>
591 <Hsp>
592 <Hsp_num>1</Hsp_num>
593 <Hsp_bit-score>37.4867</Hsp_bit-score>
594 <Hsp_score>86</Hsp_score>
595 <Hsp_evalue>0.00363998</Hsp_evalue>
596 <Hsp_query-from>57</Hsp_query-from>
597 <Hsp_query-to>184</Hsp_query-to>
598 <Hsp_hit-from>73</Hsp_hit-from>
599 <Hsp_hit-to>198</Hsp_hit-to>
600 <Hsp_query-frame>1</Hsp_query-frame>
601 <Hsp_hit-frame>1</Hsp_hit-frame>
602 <Hsp_identity>31</Hsp_identity>
603 <Hsp_positive>53</Hsp_positive>
604 <Hsp_gaps>24</Hsp_gaps>
605 <Hsp_align-len>139</Hsp_align-len>
606 <Hsp_qseq>KLIQIQDNGTGIRKEDL-------DIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVA-HVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEY---GKILEVVGRYS</Hsp_qseq>
607 <Hsp_hseq>KVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMI---GQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTIL----------RLFLKDDQLEYLEEKRIKEVIKRHS</Hsp_hseq>
608 <Hsp_midline>K+++I+D+G G+ K +L + L + D++ I G G S+ VA V + +K+ D + S + G G + R LK+ EY +I EV+ R+S</Hsp_midline>
609 </Hsp>
610 </Hit_hsps>
611 </Hit>
612 <Hit>
613 <Hit_num>22</Hit_num>
614 <Hit_id>gnl|BL_ORD_ID|15148</Hit_id>
615 <Hit_def>pdb|2IOR|A protein</Hit_def>
616 <Hit_accession>15148</Hit_accession>
617 <Hit_len>235</Hit_len>
618 <Hit_hsps>
619 <Hsp>
620 <Hsp_num>1</Hsp_num>
621 <Hsp_bit-score>37.1015</Hsp_bit-score>
622 <Hsp_score>85</Hsp_score>
623 <Hsp_evalue>0.00430103</Hsp_evalue>
624 <Hsp_query-from>32</Hsp_query-from>
625 <Hsp_query-to>151</Hsp_query-to>
626 <Hsp_hit-from>52</Hsp_hit-from>
627 <Hsp_hit-to>197</Hsp_hit-to>
628 <Hsp_query-frame>1</Hsp_query-frame>
629 <Hsp_hit-frame>1</Hsp_hit-frame>
630 <Hsp_identity>29</Hsp_identity>
631 <Hsp_positive>53</Hsp_positive>
632 <Hsp_gaps>28</Hsp_gaps>
633 <Hsp_align-len>147</Hsp_align-len>
634 <Hsp_qseq>IKEMIENCLDA------------------KSTSIQVIVKEGGLKLIQIQDNGTGIRKED----LDIVCERFTTSKLQSFEDLASIST--YGFRGEALASISHVA-HVTITTKTADG--KCAYRASYSDGKLKAPPKPCAGNQGTQIT</Hsp_qseq>
635 <Hsp_hseq>LRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKD-KRTLTISDNGVGMTRDEVIDHLGTIAKSGTKSFLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEIT</Hsp_hseq>
636 <Hsp_midline>++E+I N DA ++V + + + I DNG G+ +++ L + + T S L+S + + G G S VA VT+ T+ A + + ++GT+IT</Hsp_midline>
637 </Hsp>
638 </Hit_hsps>
639 </Hit>
640 <Hit>
641 <Hit_num>23</Hit_num>
642 <Hit_id>gnl|BL_ORD_ID|10622</Hit_id>
643 <Hit_def>pdb|1ZXM|A B protein</Hit_def>
644 <Hit_accession>10622</Hit_accession>
645 <Hit_len>400</Hit_len>
646 <Hit_hsps>
647 <Hsp>
648 <Hsp_num>1</Hsp_num>
649 <Hsp_bit-score>36.3311</Hsp_bit-score>
650 <Hsp_score>83</Hsp_score>
651 <Hsp_evalue>0.008963</Hsp_evalue>
652 <Hsp_query-from>41</Hsp_query-from>
653 <Hsp_query-to>216</Hsp_query-to>
654 <Hsp_hit-from>71</Hsp_hit-from>
655 <Hsp_hit-to>251</Hsp_hit-to>
656 <Hsp_query-frame>1</Hsp_query-frame>
657 <Hsp_hit-frame>1</Hsp_hit-frame>
658 <Hsp_identity>31</Hsp_identity>
659 <Hsp_positive>61</Hsp_positive>
660 <Hsp_gaps>19</Hsp_gaps>
661 <Hsp_align-len>188</Hsp_align-len>
662 <Hsp_qseq>DAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLD--------IVCERFTTSKLQSFEDLASISTYGFRGEALASISHVA-HVTITTKTADGKCAYR---ASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNI</Hsp_qseq>
663 <Hsp_hseq>DPKMSCIRVTIDPE-NNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTS--SNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCIT----FQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKL</Hsp_hseq>
664 <Hsp_midline>D K + I+V + LI I +NG GI + ++ + TS +++D T G G + + T+ T + + K ++ + KP G T IT F ++ K + ++ + + + V R+ + D +</Hsp_midline>
665 </Hsp>
666 </Hit_hsps>
667 </Hit>
668 <Hit>
669 <Hit_num>24</Hit_num>
670 <Hit_id>gnl|BL_ORD_ID|5852</Hit_id>
671 <Hit_def>pdb|1PVG|A B protein</Hit_def>
672 <Hit_accession>5852</Hit_accession>
673 <Hit_len>418</Hit_len>
674 <Hit_hsps>
675 <Hsp>
676 <Hsp_num>1</Hsp_num>
677 <Hsp_bit-score>32.4791</Hsp_bit-score>
678 <Hsp_score>73</Hsp_score>
679 <Hsp_evalue>0.108623</Hsp_evalue>
680 <Hsp_query-from>24</Hsp_query-from>
681 <Hsp_query-to>101</Hsp_query-to>
682 <Hsp_hit-from>61</Hsp_hit-from>
683 <Hsp_hit-to>148</Hsp_hit-to>
684 <Hsp_query-frame>1</Hsp_query-frame>
685 <Hsp_hit-frame>1</Hsp_hit-frame>
686 <Hsp_identity>17</Hsp_identity>
687 <Hsp_positive>32</Hsp_positive>
688 <Hsp_gaps>16</Hsp_gaps>
689 <Hsp_align-len>91</Hsp_align-len>
690 <Hsp_qseq>VIQRPANAIKEMIENCLDAK-----STSIQVIVKEGGLKLIQIQDNGTGIRKEDL--------DIVCERFTTSKLQSFEDLASISTYGFRG</Hsp_qseq>
691 <Hsp_hseq>IVPGLFKIFDEILVNAADNKVRDPSXKRIDVNIHAEEHT-IEVKNDGKGIPIEIHNKENIYIPEXIFGHLLTS--SNYDDDEKKVTGGRNG</Hsp_hseq>
692 <Hsp_midline>++ E++ N D K I V + I+++++G GI E + + TS +++D T G G</Hsp_midline>
693 </Hsp>
694 </Hit_hsps>
695 </Hit>
696 <Hit>
697 <Hit_num>25</Hit_num>
698 <Hit_id>gnl|BL_ORD_ID|2323</Hit_id>
699 <Hit_def>pdb|1GKZ|A protein</Hit_def>
700 <Hit_accession>2323</Hit_accession>
701 <Hit_len>388</Hit_len>
702 <Hit_hsps>
703 <Hsp>
704 <Hsp_num>1</Hsp_num>
705 <Hsp_bit-score>31.3235</Hsp_bit-score>
706 <Hsp_score>70</Hsp_score>
707 <Hsp_evalue>0.239977</Hsp_evalue>
708 <Hsp_query-from>34</Hsp_query-from>
709 <Hsp_query-to>90</Hsp_query-to>
710 <Hsp_hit-from>245</Hsp_hit-from>
711 <Hsp_hit-to>312</Hsp_hit-to>
712 <Hsp_query-frame>1</Hsp_query-frame>
713 <Hsp_hit-frame>1</Hsp_hit-frame>
714 <Hsp_identity>17</Hsp_identity>
715 <Hsp_positive>30</Hsp_positive>
716 <Hsp_gaps>11</Hsp_gaps>
717 <Hsp_align-len>68</Hsp_align-len>
718 <Hsp_qseq>EMIENCLDA----------KSTSIQVIVKEGGLKLI-QIQDNGTGIRKEDLDIVCERFTTSKLQSFED</Hsp_qseq>
719 <Hsp_hseq>ELLKNAMRATMESHLDTPYNVPDVVITIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQD</Hsp_hseq>
720 <Hsp_midline>E+++N + A + + + + LI +I D G GI +DLD V + T+ S +D</Hsp_midline>
721 </Hsp>
722 </Hit_hsps>
723 </Hit>
724 <Hit>
725 <Hit_num>26</Hit_num>
726 <Hit_id>gnl|BL_ORD_ID|7379</Hit_id>
727 <Hit_def>pdb|1TH8|A protein</Hit_def>
728 <Hit_accession>7379</Hit_accession>
729 <Hit_len>145</Hit_len>
730 <Hit_hsps>
731 <Hsp>
732 <Hsp_num>1</Hsp_num>
733 <Hsp_bit-score>30.9383</Hsp_bit-score>
734 <Hsp_score>69</Hsp_score>
735 <Hsp_evalue>0.300613</Hsp_evalue>
736 <Hsp_query-from>30</Hsp_query-from>
737 <Hsp_query-to>84</Hsp_query-to>
738 <Hsp_hit-from>42</Hsp_hit-from>
739 <Hsp_hit-to>100</Hsp_hit-to>
740 <Hsp_query-frame>1</Hsp_query-frame>
741 <Hsp_hit-frame>1</Hsp_hit-frame>
742 <Hsp_identity>14</Hsp_identity>
743 <Hsp_positive>28</Hsp_positive>
744 <Hsp_gaps>10</Hsp_gaps>
745 <Hsp_align-len>62</Hsp_align-len>
746 <Hsp_qseq>NAIKEMIENCLDAKSTS-------IQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK</Hsp_qseq>
747 <Hsp_hseq>TVVSEAVTNAIIHGYNNDPNGIVSISVIIEDGVVHL-TVRDEGVGIP--DIEEARQPLFTTK</Hsp_hseq>
748 <Hsp_midline> + E + N + + I VI+++G + L ++D G GI D++ + T+K</Hsp_midline>
749 </Hsp>
750 </Hit_hsps>
751 </Hit>
752 <Hit>
753 <Hit_num>27</Hit_num>
754 <Hit_id>gnl|BL_ORD_ID|10088</Hit_id>
755 <Hit_def>pdb|1YSR|A B C protein</Hit_def>
756 <Hit_accession>10088</Hit_accession>
757 <Hit_len>150</Hit_len>
758 <Hit_hsps>
759 <Hsp>
760 <Hsp_num>1</Hsp_num>
761 <Hsp_bit-score>30.1679</Hsp_bit-score>
762 <Hsp_score>67</Hsp_score>
763 <Hsp_evalue>0.53017</Hsp_evalue>
764 <Hsp_query-from>36</Hsp_query-from>
765 <Hsp_query-to>114</Hsp_query-to>
766 <Hsp_hit-from>51</Hsp_hit-from>
767 <Hsp_hit-to>126</Hsp_hit-to>
768 <Hsp_query-frame>1</Hsp_query-frame>
769 <Hsp_hit-frame>1</Hsp_hit-frame>
770 <Hsp_identity>20</Hsp_identity>
771 <Hsp_positive>38</Hsp_positive>
772 <Hsp_gaps>17</Hsp_gaps>
773 <Hsp_align-len>86</Hsp_align-len>
774 <Hsp_qseq>IENCL-----DAKSTSIQVI--VKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVT</Hsp_qseq>
775 <Hsp_hseq>VDNAIANAVKHGGATLVQLSAVSSRAGVE-IAIDDNGSGVPEGERQVVFER--------FSRGSTASHSG-SGLGLALVAQQAQLH</Hsp_hseq>
776 <Hsp_midline>++N + +T +Q+ G++ I I DNG+G+ + + +V ER F ++ S G G LA ++ A + </Hsp_midline>
777 </Hsp>
778 </Hit_hsps>
779 </Hit>
780 <Hit>
781 <Hit_num>28</Hit_num>
782 <Hit_id>gnl|BL_ORD_ID|13796</Hit_id>
783 <Hit_def>pdb|2FUE|A protein</Hit_def>
784 <Hit_accession>13796</Hit_accession>
785 <Hit_len>262</Hit_len>
786 <Hit_hsps>
787 <Hsp>
788 <Hsp_num>1</Hsp_num>
789 <Hsp_bit-score>29.3975</Hsp_bit-score>
790 <Hsp_score>65</Hsp_score>
791 <Hsp_evalue>0.911911</Hsp_evalue>
792 <Hsp_query-from>125</Hsp_query-from>
793 <Hsp_query-to>260</Hsp_query-to>
794 <Hsp_hit-from>126</Hsp_hit-from>
795 <Hsp_hit-to>256</Hsp_hit-to>
796 <Hsp_query-frame>1</Hsp_query-frame>
797 <Hsp_hit-frame>1</Hsp_hit-frame>
798 <Hsp_identity>22</Hsp_identity>
799 <Hsp_positive>36</Hsp_positive>
800 <Hsp_gaps>5</Hsp_gaps>
801 <Hsp_align-len>136</Hsp_align-len>
802 <Hsp_qseq>AYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLL</Hsp_qseq>
803 <Hsp_hseq>GTFIEFRNGXLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSR----GGXISFDVFPEGWDKRYCLDSLDQDSFDTI-HFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFP</Hsp_hseq>
804 <Hsp_midline> + +G L P + +I +L R K ++ E+ R ISF V +G + + D I FGN S + + + IF </Hsp_midline>
805 </Hsp>
806 </Hit_hsps>
807 </Hit>
808 <Hit>
809 <Hit_num>29</Hit_num>
810 <Hit_id>gnl|BL_ORD_ID|11588</Hit_id>
811 <Hit_def>pdb|2C2A|A protein</Hit_def>
812 <Hit_accession>11588</Hit_accession>
813 <Hit_len>258</Hit_len>
814 <Hit_hsps>
815 <Hsp>
816 <Hsp_num>1</Hsp_num>
817 <Hsp_bit-score>29.0123</Hsp_bit-score>
818 <Hsp_score>64</Hsp_score>
819 <Hsp_evalue>1.29463</Hsp_evalue>
820 <Hsp_query-from>26</Hsp_query-from>
821 <Hsp_query-to>69</Hsp_query-to>
822 <Hsp_hit-from>137</Hsp_hit-from>
823 <Hsp_hit-to>186</Hsp_hit-to>
824 <Hsp_query-frame>1</Hsp_query-frame>
825 <Hsp_hit-frame>1</Hsp_hit-frame>
826 <Hsp_identity>16</Hsp_identity>
827 <Hsp_positive>27</Hsp_positive>
828 <Hsp_gaps>8</Hsp_gaps>
829 <Hsp_align-len>51</Hsp_align-len>
830 <Hsp_qseq>QRPANAIKEMIENCL-----DAKSTSIQVIV--KEGGLKLIQIQDNGTGIR</Hsp_qseq>
831 <Hsp_hseq>TRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGV-LIIVEDNGIGIP</Hsp_hseq>
832 <Hsp_midline> R + ++ N + DA ++VI+ K+GG+ LI ++DNG GI </Hsp_midline>
833 </Hsp>
834 </Hit_hsps>
835 </Hit>
836 <Hit>
837 <Hit_num>30</Hit_num>
838 <Hit_id>gnl|BL_ORD_ID|11239</Hit_id>
839 <Hit_def>pdb|2B9S|A protein</Hit_def>
840 <Hit_accession>11239</Hit_accession>
841 <Hit_len>432</Hit_len>
842 <Hit_hsps>
843 <Hsp>
844 <Hsp_num>1</Hsp_num>
845 <Hsp_bit-score>28.2419</Hsp_bit-score>
846 <Hsp_score>62</Hsp_score>
847 <Hsp_evalue>2.42058</Hsp_evalue>
848 <Hsp_query-from>119</Hsp_query-from>
849 <Hsp_query-to>186</Hsp_query-to>
850 <Hsp_hit-from>34</Hsp_hit-from>
851 <Hsp_hit-to>102</Hsp_hit-to>
852 <Hsp_query-frame>1</Hsp_query-frame>
853 <Hsp_hit-frame>1</Hsp_hit-frame>
854 <Hsp_identity>10</Hsp_identity>
855 <Hsp_positive>19</Hsp_positive>
856 <Hsp_gaps>5</Hsp_gaps>
857 <Hsp_align-len>71</Hsp_align-len>
858 <Hsp_qseq>TADGKCAYRASYSDG--KLKAPPKPCAGNQGTQITVEDLFYNIAT-RRKALKNPSEEYGKILEVVGRYSVH</Hsp_qseq>
859 <Hsp_hseq>PEYEPHGIPIFYDGREFKMTPEEEEVATM--FAVMKEHDYYRMEVFRRNFFESWREILDKRQHPIRRLELC</Hsp_hseq>
860 <Hsp_midline> Y K+ + A + E +Y + RR ++ E K + R + </Hsp_midline>
861 </Hsp>
862 </Hit_hsps>
863 </Hit>
864 <Hit>
865 <Hit_num>31</Hit_num>
866 <Hit_id>gnl|BL_ORD_ID|2030</Hit_id>
867 <Hit_def>pdb|1FRB|A protein</Hit_def>
868 <Hit_accession>2030</Hit_accession>
869 <Hit_len>315</Hit_len>
870 <Hit_hsps>
871 <Hsp>
872 <Hsp_num>1</Hsp_num>
873 <Hsp_bit-score>27.8567</Hsp_bit-score>
874 <Hsp_score>61</Hsp_score>
875 <Hsp_evalue>2.63121</Hsp_evalue>
876 <Hsp_query-from>27</Hsp_query-from>
877 <Hsp_query-to>48</Hsp_query-to>
878 <Hsp_hit-from>22</Hsp_hit-from>
879 <Hsp_hit-to>43</Hsp_hit-to>
880 <Hsp_query-frame>1</Hsp_query-frame>
881 <Hsp_hit-frame>1</Hsp_hit-frame>
882 <Hsp_identity>7</Hsp_identity>
883 <Hsp_positive>11</Hsp_positive>
884 <Hsp_align-len>22</Hsp_align-len>
885 <Hsp_qseq>RPANAIKEMIENCLDAKSTSIQ</Hsp_qseq>
886 <Hsp_hseq>SPPNQVKEAVKAAIDAGYRHID</Hsp_hseq>
887 <Hsp_midline> P N +KE ++ +DA I </Hsp_midline>
888 </Hsp>
889 </Hit_hsps>
890 </Hit>
891 <Hit>
892 <Hit_num>32</Hit_num>
893 <Hit_id>gnl|BL_ORD_ID|12828</Hit_id>
894 <Hit_def>pdb|2E5W|A B C D protein</Hit_def>
895 <Hit_accession>12828</Hit_accession>
896 <Hit_len>280</Hit_len>
897 <Hit_hsps>
898 <Hsp>
899 <Hsp_num>1</Hsp_num>
900 <Hsp_bit-score>27.4715</Hsp_bit-score>
901 <Hsp_score>60</Hsp_score>
902 <Hsp_evalue>3.2415</Hsp_evalue>
903 <Hsp_query-from>259</Hsp_query-from>
904 <Hsp_query-to>326</Hsp_query-to>
905 <Hsp_hit-from>199</Hsp_hit-from>
906 <Hsp_hit-to>280</Hsp_hit-to>
907 <Hsp_query-frame>1</Hsp_query-frame>
908 <Hsp_hit-frame>1</Hsp_hit-frame>
909 <Hsp_identity>17</Hsp_identity>
910 <Hsp_positive>30</Hsp_positive>
911 <Hsp_gaps>22</Hsp_gaps>
912 <Hsp_align-len>86</Hsp_align-len>
913 <Hsp_qseq>LLFINHRLVESTSLRKAIETVYAAYLPKNTH--PFLYL--------SLEISPQN--------VDVNVHPTKHEVHFLHEESILERV</Hsp_qseq>
914 <Hsp_hseq>YLFTDEFLTAYRKMRKVFDKVYYYSFPVIGYASPWAFLVGVKGSIDFMKVDAEKGKKLGLEYYD----PDKHETLFQMPRYIVQML</Hsp_hseq>
915 <Hsp_midline> LF + L +RK + VY P + P+ +L +++ + D P KHE F I++ +</Hsp_midline>
916 </Hsp>
917 </Hit_hsps>
918 </Hit>
919 <Hit>
920 <Hit_num>33</Hit_num>
921 <Hit_id>gnl|BL_ORD_ID|12786</Hit_id>
922 <Hit_def>pdb|2E3N|A protein</Hit_def>
923 <Hit_accession>12786</Hit_accession>
924 <Hit_len>255</Hit_len>
925 <Hit_hsps>
926 <Hsp>
927 <Hsp_num>1</Hsp_num>
928 <Hsp_bit-score>27.4715</Hsp_bit-score>
929 <Hsp_score>60</Hsp_score>
930 <Hsp_evalue>3.43646</Hsp_evalue>
931 <Hsp_query-from>120</Hsp_query-from>
932 <Hsp_query-to>162</Hsp_query-to>
933 <Hsp_hit-from>55</Hsp_hit-from>
934 <Hsp_hit-to>99</Hsp_hit-to>
935 <Hsp_query-frame>1</Hsp_query-frame>
936 <Hsp_hit-frame>1</Hsp_hit-frame>
937 <Hsp_identity>8</Hsp_identity>
938 <Hsp_positive>13</Hsp_positive>
939 <Hsp_gaps>2</Hsp_gaps>
940 <Hsp_align-len>45</Hsp_align-len>
941 <Hsp_qseq>ADGKCAYRASYSDGKLKAPPKPCAGNQG--TQITVEDLFYNIATR</Hsp_qseq>
942 <Hsp_hseq>EGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVR</Hsp_hseq>
943 <Hsp_midline> YR + + P T V + F+N+ R</Hsp_midline>
944 </Hsp>
945 </Hit_hsps>
946 </Hit>
947 <Hit>
948 <Hit_num>34</Hit_num>
949 <Hit_id>gnl|BL_ORD_ID|3943</Hit_id>
950 <Hit_def>pdb|1KQF|A protein</Hit_def>
951 <Hit_accession>3943</Hit_accession>
952 <Hit_len>1015</Hit_len>
953 <Hit_hsps>
954 <Hsp>
955 <Hsp_num>1</Hsp_num>
956 <Hsp_bit-score>26.7011</Hsp_bit-score>
957 <Hsp_score>58</Hsp_score>
958 <Hsp_evalue>6.06066</Hsp_evalue>
959 <Hsp_query-from>19</Hsp_query-from>
960 <Hsp_query-to>64</Hsp_query-to>
961 <Hsp_hit-from>275</Hsp_hit-from>
962 <Hsp_hit-to>315</Hsp_hit-to>
963 <Hsp_query-frame>1</Hsp_query-frame>
964 <Hsp_hit-frame>1</Hsp_hit-frame>
965 <Hsp_identity>10</Hsp_identity>
966 <Hsp_positive>22</Hsp_positive>
967 <Hsp_gaps>7</Hsp_gaps>
968 <Hsp_align-len>47</Hsp_align-len>
969 <Hsp_qseq>IAAGEVIQRPANAIKEMIENC-LDAKSTSIQVIVKEGGLKLIQIQDN</Hsp_qseq>
970 <Hsp_hseq>IRSGTDITFLSGVLRYLIENNKINAEY------VKHYTNASLLVRDD</Hsp_hseq>
971 <Hsp_midline>I +G I + ++ +IEN ++A+ VK + ++D+</Hsp_midline>
972 </Hsp>
973 </Hit_hsps>
974 </Hit>
975 <Hit>
976 <Hit_num>35</Hit_num>
977 <Hit_id>gnl|BL_ORD_ID|2889</Hit_id>
978 <Hit_def>pdb|1I58|A B protein</Hit_def>
979 <Hit_accession>2889</Hit_accession>
980 <Hit_len>189</Hit_len>
981 <Hit_hsps>
982 <Hsp>
983 <Hsp_num>1</Hsp_num>
984 <Hsp_bit-score>26.7011</Hsp_bit-score>
985 <Hsp_score>58</Hsp_score>
986 <Hsp_evalue>6.98428</Hsp_evalue>
987 <Hsp_query-from>59</Hsp_query-from>
988 <Hsp_query-to>71</Hsp_query-to>
989 <Hsp_hit-from>94</Hsp_hit-from>
990 <Hsp_hit-to>106</Hsp_hit-to>
991 <Hsp_query-frame>1</Hsp_query-frame>
992 <Hsp_hit-frame>1</Hsp_hit-frame>
993 <Hsp_identity>7</Hsp_identity>
994 <Hsp_positive>11</Hsp_positive>
995 <Hsp_align-len>13</Hsp_align-len>
996 <Hsp_qseq>IQIQDNGTGIRKE</Hsp_qseq>
997 <Hsp_hseq>IEVEDDGRGIDKE</Hsp_hseq>
998 <Hsp_midline>I+++D+G GI KE</Hsp_midline>
999 </Hsp>
1000 </Hit_hsps>
1001 </Hit>
1002 <Hit>
1003 <Hit_num>36</Hit_num>
1004 <Hit_id>gnl|BL_ORD_ID|7642</Hit_id>
1005 <Hit_def>pdb|1U3D|A protein</Hit_def>
1006 <Hit_accession>7642</Hit_accession>
1007 <Hit_len>509</Hit_len>
1008 <Hit_hsps>
1009 <Hsp>
1010 <Hsp_num>1</Hsp_num>
1011 <Hsp_bit-score>26.3159</Hsp_bit-score>
1012 <Hsp_score>57</Hsp_score>
1013 <Hsp_evalue>7.71979</Hsp_evalue>
1014 <Hsp_query-from>222</Hsp_query-from>
1015 <Hsp_query-to>289</Hsp_query-to>
1016 <Hsp_hit-from>188</Hsp_hit-from>
1017 <Hsp_hit-to>255</Hsp_hit-to>
1018 <Hsp_query-frame>1</Hsp_query-frame>
1019 <Hsp_hit-frame>1</Hsp_hit-frame>
1020 <Hsp_identity>9</Hsp_identity>
1021 <Hsp_positive>26</Hsp_positive>
1022 <Hsp_align-len>68</Hsp_align-len>
1023 <Hsp_qseq>NAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTH</Hsp_qseq>
1024 <Hsp_hseq>SKCVADPLVFEDDSEKGSNALLARAWSPGWSNGDKALTTFINGPLLEYSKNRRKADSATTSFLSPHLH</Hsp_hseq>
1025 <Hsp_midline>+ + + + + + + + +S FIN L+E + R+ ++ ++L + H</Hsp_midline>
1026 </Hsp>
1027 </Hit_hsps>
1028 </Hit>
1029 <Hit>
1030 <Hit_num>37</Hit_num>
1031 <Hit_id>gnl|BL_ORD_ID|374</Hit_id>
1032 <Hit_def>pdb|1B3Q|A B protein</Hit_def>
1033 <Hit_accession>374</Hit_accession>
1034 <Hit_len>379</Hit_len>
1035 <Hit_hsps>
1036 <Hsp>
1037 <Hsp_num>1</Hsp_num>
1038 <Hsp_bit-score>26.3159</Hsp_bit-score>
1039 <Hsp_score>57</Hsp_score>
1040 <Hsp_evalue>8.04866</Hsp_evalue>
1041 <Hsp_query-from>59</Hsp_query-from>
1042 <Hsp_query-to>71</Hsp_query-to>
1043 <Hsp_hit-from>153</Hsp_hit-from>
1044 <Hsp_hit-to>165</Hsp_hit-to>
1045 <Hsp_query-frame>1</Hsp_query-frame>
1046 <Hsp_hit-frame>1</Hsp_hit-frame>
1047 <Hsp_identity>7</Hsp_identity>
1048 <Hsp_positive>11</Hsp_positive>
1049 <Hsp_align-len>13</Hsp_align-len>
1050 <Hsp_qseq>IQIQDNGTGIRKE</Hsp_qseq>
1051 <Hsp_hseq>IEVEDDGRGIDKE</Hsp_hseq>
1052 <Hsp_midline>I+++D+G GI KE</Hsp_midline>
1053 </Hsp>
1054 </Hit_hsps>
1055 </Hit>
1056 <Hit>
1057 <Hit_num>38</Hit_num>
1058 <Hit_id>gnl|BL_ORD_ID|11760</Hit_id>
1059 <Hit_def>pdb|2CH4|A B protein</Hit_def>
1060 <Hit_accession>11760</Hit_accession>
1061 <Hit_len>320</Hit_len>
1062 <Hit_hsps>
1063 <Hsp>
1064 <Hsp_num>1</Hsp_num>
1065 <Hsp_bit-score>26.3159</Hsp_bit-score>
1066 <Hsp_score>57</Hsp_score>
1067 <Hsp_evalue>8.04866</Hsp_evalue>
1068 <Hsp_query-from>59</Hsp_query-from>
1069 <Hsp_query-to>71</Hsp_query-to>
1070 <Hsp_hit-from>94</Hsp_hit-from>
1071 <Hsp_hit-to>106</Hsp_hit-to>
1072 <Hsp_query-frame>1</Hsp_query-frame>
1073 <Hsp_hit-frame>1</Hsp_hit-frame>
1074 <Hsp_identity>7</Hsp_identity>
1075 <Hsp_positive>11</Hsp_positive>
1076 <Hsp_align-len>13</Hsp_align-len>
1077 <Hsp_qseq>IQIQDNGTGIRKE</Hsp_qseq>
1078 <Hsp_hseq>IEVEDDGRGIDKE</Hsp_hseq>
1079 <Hsp_midline>I+++D+G GI KE</Hsp_midline>
1080 </Hsp>
1081 </Hit_hsps>
1082 </Hit>
1083 </Iteration_hits>
1084 <Iteration_stat>
1085 <Statistics>
1086 <Statistics_db-num>20430</Statistics_db-num>
1087 <Statistics_db-len>4636376</Statistics_db-len>
1088 <Statistics_hsp-len>92</Statistics_hsp-len>
1089 <Statistics_eff-space>6.8369e+08</Statistics_eff-space>
1090 <Statistics_kappa>0.0488661</Statistics_kappa>
1091 <Statistics_lambda>0.267</Statistics_lambda>
1092 <Statistics_entropy>0.14</Statistics_entropy>
1093 </Statistics>
1094 </Iteration_stat>
1095 </Iteration>
1096 </BlastOutput_iterations>
1097 </BlastOutput>