ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/reconstruct/sample.cm
Revision: 978
Committed: Tue Feb 23 18:57:24 2010 UTC (9 years, 8 months ago) by duarte
File size: 3520 byte(s)
Log Message:
Moved all reconstruct scripts and config files to reconstruct directory. 
Modified scripts accordingly
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVEVVE
3 #PDB: 1bxy
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: Cb
8 #CUTOFF: 8.0
9 1 2 1.000
10 1 3 1.000
11 1 38 1.000
12 1 39 1.000
13 2 3 1.000
14 2 38 1.000
15 2 39 1.000
16 2 58 1.000
17 2 60 1.000
18 3 4 1.000
19 3 5 1.000
20 3 36 1.000
21 3 37 1.000
22 3 38 1.000
23 3 39 1.000
24 3 59 1.000
25 3 60 1.000
26 4 5 1.000
27 4 6 1.000
28 4 36 1.000
29 4 37 1.000
30 4 38 1.000
31 4 39 1.000
32 4 43 1.000
33 4 44 1.000
34 4 47 1.000
35 4 56 1.000
36 4 57 1.000
37 4 58 1.000
38 4 59 1.000
39 5 6 1.000
40 5 7 1.000
41 5 34 1.000
42 5 35 1.000
43 5 36 1.000
44 5 37 1.000
45 5 56 1.000
46 5 57 1.000
47 5 58 1.000
48 5 59 1.000
49 6 7 1.000
50 6 8 1.000
51 6 26 1.000
52 6 28 1.000
53 6 34 1.000
54 6 35 1.000
55 6 36 1.000
56 6 37 1.000
57 6 47 1.000
58 6 54 1.000
59 6 55 1.000
60 6 56 1.000
61 7 8 1.000
62 7 9 1.000
63 7 32 1.000
64 7 33 1.000
65 7 34 1.000
66 7 35 1.000
67 7 54 1.000
68 7 55 1.000
69 7 56 1.000
70 7 57 1.000
71 8 9 1.000
72 8 10 1.000
73 8 12 1.000
74 8 23 1.000
75 8 28 1.000
76 8 29 1.000
77 8 30 1.000
78 8 31 1.000
79 8 32 1.000
80 8 33 1.000
81 8 34 1.000
82 8 53 1.000
83 8 54 1.000
84 8 55 1.000
85 9 10 1.000
86 9 31 1.000
87 9 32 1.000
88 9 53 1.000
89 9 54 1.000
90 9 55 1.000
91 10 11 1.000
92 10 12 1.000
93 10 31 1.000
94 10 52 1.000
95 10 53 1.000
96 10 54 1.000
97 11 12 1.000
98 11 13 1.000
99 11 31 1.000
100 11 53 1.000
101 12 13 1.000
102 12 14 1.000
103 12 15 1.000
104 12 19 1.000
105 12 20 1.000
106 12 23 1.000
107 12 50 1.000
108 12 53 1.000
109 13 14 1.000
110 13 15 1.000
111 14 15 1.000
112 14 16 1.000
113 14 20 1.000
114 15 16 1.000
115 15 19 1.000
116 15 20 1.000
117 15 53 1.000
118 16 17 1.000
119 16 18 1.000
120 16 19 1.000
121 16 20 1.000
122 17 18 1.000
123 17 19 1.000
124 17 20 1.000
125 17 21 1.000
126 18 19 1.000
127 18 20 1.000
128 18 21 1.000
129 18 22 1.000
130 18 49 1.000
131 19 20 1.000
132 19 21 1.000
133 19 22 1.000
134 19 23 1.000
135 19 49 1.000
136 19 50 1.000
137 19 53 1.000
138 20 21 1.000
139 20 22 1.000
140 20 23 1.000
141 20 24 1.000
142 21 22 1.000
143 21 23 1.000
144 21 24 1.000
145 21 25 1.000
146 22 23 1.000
147 22 24 1.000
148 22 25 1.000
149 22 26 1.000
150 22 45 1.000
151 22 46 1.000
152 22 47 1.000
153 22 49 1.000
154 22 50 1.000
155 23 24 1.000
156 23 25 1.000
157 23 26 1.000
158 23 27 1.000
159 23 28 1.000
160 23 29 1.000
161 23 50 1.000
162 23 53 1.000
163 24 25 1.000
164 24 26 1.000
165 24 27 1.000
166 25 26 1.000
167 25 27 1.000
168 25 46 1.000
169 26 27 1.000
170 26 28 1.000
171 26 35 1.000
172 26 37 1.000
173 26 43 1.000
174 26 46 1.000
175 26 47 1.000
176 26 50 1.000
177 26 54 1.000
178 27 28 1.000
179 27 29 1.000
180 27 33 1.000
181 27 35 1.000
182 28 29 1.000
183 28 30 1.000
184 28 33 1.000
185 28 35 1.000
186 28 50 1.000
187 28 54 1.000
188 29 30 1.000
189 29 33 1.000
190 30 31 1.000
191 30 32 1.000
192 30 33 1.000
193 31 32 1.000
194 31 33 1.000
195 32 33 1.000
196 32 34 1.000
197 33 34 1.000
198 33 35 1.000
199 34 35 1.000
200 34 36 1.000
201 35 36 1.000
202 35 37 1.000
203 36 37 1.000
204 36 59 1.000
205 37 38 1.000
206 37 39 1.000
207 37 43 1.000
208 38 39 1.000
209 38 40 1.000
210 38 43 1.000
211 39 40 1.000
212 39 43 1.000
213 39 44 1.000
214 39 58 1.000
215 40 41 1.000
216 40 42 1.000
217 40 43 1.000
218 40 44 1.000
219 41 42 1.000
220 41 43 1.000
221 41 44 1.000
222 41 45 1.000
223 42 43 1.000
224 42 44 1.000
225 42 45 1.000
226 42 46 1.000
227 43 44 1.000
228 43 45 1.000
229 43 46 1.000
230 43 47 1.000
231 44 45 1.000
232 44 46 1.000
233 44 47 1.000
234 44 48 1.000
235 45 46 1.000
236 45 47 1.000
237 45 48 1.000
238 45 49 1.000
239 46 47 1.000
240 46 48 1.000
241 46 49 1.000
242 46 50 1.000
243 47 48 1.000
244 47 49 1.000
245 47 50 1.000
246 47 51 1.000
247 47 54 1.000
248 47 56 1.000
249 48 49 1.000
250 48 50 1.000
251 48 51 1.000
252 49 50 1.000
253 49 51 1.000
254 50 51 1.000
255 50 52 1.000
256 50 53 1.000
257 50 54 1.000
258 51 52 1.000
259 51 53 1.000
260 51 54 1.000
261 52 53 1.000
262 52 54 1.000
263 53 54 1.000
264 54 55 1.000
265 54 56 1.000
266 55 56 1.000
267 55 57 1.000
268 56 57 1.000
269 56 58 1.000
270 57 58 1.000
271 57 59 1.000
272 58 59 1.000
273 59 60 1.000