ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/src/owl/tests/core/structure/data/1d2sA_BB:SC_5.0.cm
Revision: 1008
Committed: Wed Mar 31 14:03:27 2010 UTC (9 years, 6 months ago) by hstehr
File size: 11722 byte(s)
Log Message:
refactoring: adapting test packages to match new package structure
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
3 #PDB: 1d2s
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: BB/SC
8 #CUTOFF: 5.0
9 1 2 1.000
10 1 3 1.000
11 1 148 1.000
12 2 1 1.000
13 2 3 1.000
14 2 148 1.000
15 3 2 1.000
16 3 4 1.000
17 3 148 1.000
18 3 169 1.000
19 3 170 1.000
20 4 3 1.000
21 4 5 1.000
22 4 6 1.000
23 4 146 1.000
24 4 147 1.000
25 4 170 1.000
26 5 4 1.000
27 5 6 1.000
28 5 15 1.000
29 5 146 1.000
30 5 170 1.000
31 6 5 1.000
32 6 7 1.000
33 6 15 1.000
34 7 5 1.000
35 7 6 1.000
36 7 8 1.000
37 7 15 1.000
38 8 7 1.000
39 8 10 1.000
40 8 15 1.000
41 9 8 1.000
42 9 10 1.000
43 10 12 1.000
44 10 142 1.000
45 11 7 1.000
46 11 10 1.000
47 11 12 1.000
48 11 141 1.000
49 11 142 1.000
50 12 10 1.000
51 12 13 1.000
52 13 12 1.000
53 13 14 1.000
54 14 13 1.000
55 14 15 1.000
56 14 164 1.000
57 15 14 1.000
58 15 16 1.000
59 15 163 1.000
60 15 164 1.000
61 15 167 1.000
62 16 14 1.000
63 16 15 1.000
64 16 17 1.000
65 16 124 1.000
66 16 125 1.000
67 16 163 1.000
68 16 164 1.000
69 17 16 1.000
70 17 18 1.000
71 17 124 1.000
72 17 161 1.000
73 17 162 1.000
74 18 17 1.000
75 18 19 1.000
76 18 20 1.000
77 18 122 1.000
78 18 123 1.000
79 18 161 1.000
80 19 18 1.000
81 19 20 1.000
82 19 120 1.000
83 19 122 1.000
84 19 158 1.000
85 19 159 1.000
86 19 160 1.000
87 20 19 1.000
88 20 21 1.000
89 20 22 1.000
90 20 25 1.000
91 20 120 1.000
92 20 121 1.000
93 20 159 1.000
94 21 20 1.000
95 21 22 1.000
96 21 23 1.000
97 21 24 1.000
98 21 25 1.000
99 21 157 1.000
100 21 159 1.000
101 22 20 1.000
102 22 21 1.000
103 22 23 1.000
104 22 25 1.000
105 23 21 1.000
106 23 22 1.000
107 23 24 1.000
108 24 21 1.000
109 24 23 1.000
110 24 25 1.000
111 24 26 1.000
112 24 154 1.000
113 24 157 1.000
114 25 24 1.000
115 25 26 1.000
116 25 154 1.000
117 25 157 1.000
118 26 25 1.000
119 26 27 1.000
120 26 28 1.000
121 26 154 1.000
122 27 25 1.000
123 27 26 1.000
124 27 28 1.000
125 27 29 1.000
126 27 153 1.000
127 27 154 1.000
128 28 25 1.000
129 28 27 1.000
130 28 29 1.000
131 28 94 1.000
132 28 95 1.000
133 28 153 1.000
134 29 27 1.000
135 29 28 1.000
136 29 30 1.000
137 29 94 1.000
138 29 153 1.000
139 30 29 1.000
140 30 31 1.000
141 30 32 1.000
142 30 92 1.000
143 30 93 1.000
144 30 152 1.000
145 31 30 1.000
146 31 32 1.000
147 31 92 1.000
148 31 150 1.000
149 31 151 1.000
150 32 31 1.000
151 32 33 1.000
152 32 90 1.000
153 32 91 1.000
154 32 150 1.000
155 33 32 1.000
156 33 34 1.000
157 33 88 1.000
158 33 147 1.000
159 33 148 1.000
160 33 149 1.000
161 34 32 1.000
162 34 33 1.000
163 34 35 1.000
164 34 88 1.000
165 34 89 1.000
166 35 34 1.000
167 35 36 1.000
168 35 88 1.000
169 35 146 1.000
170 36 35 1.000
171 36 37 1.000
172 36 84 1.000
173 36 85 1.000
174 37 36 1.000
175 37 38 1.000
176 37 39 1.000
177 37 84 1.000
178 38 36 1.000
179 38 37 1.000
180 38 39 1.000
181 38 59 1.000
182 38 84 1.000
183 38 143 1.000
184 39 38 1.000
185 39 40 1.000
186 39 59 1.000
187 39 60 1.000
188 39 82 1.000
189 39 84 1.000
190 40 38 1.000
191 40 39 1.000
192 40 59 1.000
193 40 143 1.000
194 41 40 1.000
195 41 42 1.000
196 41 43 1.000
197 41 59 1.000
198 41 139 1.000
199 41 143 1.000
200 42 43 1.000
201 42 56 1.000
202 42 139 1.000
203 42 141 1.000
204 42 143 1.000
205 43 6 1.000
206 43 42 1.000
207 43 44 1.000
208 43 125 1.000
209 44 42 1.000
210 44 43 1.000
211 44 45 1.000
212 44 55 1.000
213 44 56 1.000
214 44 57 1.000
215 44 125 1.000
216 45 42 1.000
217 45 44 1.000
218 45 56 1.000
219 45 123 1.000
220 45 124 1.000
221 46 44 1.000
222 46 45 1.000
223 46 47 1.000
224 46 54 1.000
225 46 55 1.000
226 46 123 1.000
227 47 45 1.000
228 47 48 1.000
229 47 53 1.000
230 47 54 1.000
231 47 121 1.000
232 47 122 1.000
233 48 47 1.000
234 48 49 1.000
235 48 50 1.000
236 48 53 1.000
237 49 45 1.000
238 49 47 1.000
239 49 48 1.000
240 49 50 1.000
241 49 52 1.000
242 49 53 1.000
243 49 54 1.000
244 50 45 1.000
245 50 47 1.000
246 50 49 1.000
247 50 51 1.000
248 50 54 1.000
249 50 122 1.000
250 50 130 1.000
251 51 49 1.000
252 51 50 1.000
253 51 52 1.000
254 51 54 1.000
255 51 69 1.000
256 52 49 1.000
257 52 51 1.000
258 52 53 1.000
259 52 54 1.000
260 52 69 1.000
261 52 70 1.000
262 53 47 1.000
263 53 48 1.000
264 53 49 1.000
265 53 52 1.000
266 53 54 1.000
267 53 69 1.000
268 53 70 1.000
269 54 45 1.000
270 54 47 1.000
271 54 53 1.000
272 54 55 1.000
273 54 68 1.000
274 54 69 1.000
275 54 70 1.000
276 55 45 1.000
277 55 54 1.000
278 55 56 1.000
279 55 68 1.000
280 56 45 1.000
281 56 54 1.000
282 56 55 1.000
283 56 57 1.000
284 56 66 1.000
285 56 67 1.000
286 57 42 1.000
287 57 43 1.000
288 57 55 1.000
289 57 56 1.000
290 57 66 1.000
291 58 43 1.000
292 58 56 1.000
293 58 57 1.000
294 58 59 1.000
295 58 64 1.000
296 58 65 1.000
297 59 40 1.000
298 59 43 1.000
299 59 60 1.000
300 59 65 1.000
301 59 139 1.000
302 60 40 1.000
303 60 59 1.000
304 60 61 1.000
305 60 63 1.000
306 60 65 1.000
307 61 39 1.000
308 61 60 1.000
309 61 63 1.000
310 61 82 1.000
311 61 84 1.000
312 62 39 1.000
313 62 59 1.000
314 62 61 1.000
315 62 63 1.000
316 62 64 1.000
317 62 82 1.000
318 62 83 1.000
319 62 84 1.000
320 63 59 1.000
321 63 60 1.000
322 63 64 1.000
323 63 65 1.000
324 63 82 1.000
325 64 57 1.000
326 64 59 1.000
327 64 63 1.000
328 64 65 1.000
329 64 83 1.000
330 65 56 1.000
331 65 57 1.000
332 65 64 1.000
333 65 66 1.000
334 66 56 1.000
335 66 57 1.000
336 66 65 1.000
337 66 67 1.000
338 66 75 1.000
339 66 76 1.000
340 66 77 1.000
341 67 54 1.000
342 67 55 1.000
343 67 56 1.000
344 67 65 1.000
345 67 66 1.000
346 67 68 1.000
347 67 75 1.000
348 67 76 1.000
349 68 54 1.000
350 68 55 1.000
351 68 66 1.000
352 68 67 1.000
353 68 69 1.000
354 68 74 1.000
355 68 75 1.000
356 68 136 1.000
357 69 53 1.000
358 69 54 1.000
359 69 68 1.000
360 69 70 1.000
361 69 74 1.000
362 70 53 1.000
363 70 68 1.000
364 70 69 1.000
365 70 71 1.000
366 70 72 1.000
367 70 74 1.000
368 71 53 1.000
369 71 70 1.000
370 71 72 1.000
371 71 74 1.000
372 72 70 1.000
373 72 71 1.000
374 72 73 1.000
375 72 74 1.000
376 73 68 1.000
377 73 69 1.000
378 73 70 1.000
379 73 72 1.000
380 73 74 1.000
381 74 68 1.000
382 74 69 1.000
383 74 73 1.000
384 74 75 1.000
385 74 136 1.000
386 75 67 1.000
387 75 68 1.000
388 75 74 1.000
389 75 76 1.000
390 75 77 1.000
391 75 136 1.000
392 76 67 1.000
393 76 75 1.000
394 76 77 1.000
395 76 136 1.000
396 77 65 1.000
397 77 66 1.000
398 77 75 1.000
399 77 76 1.000
400 77 110 1.000
401 78 65 1.000
402 78 77 1.000
403 78 79 1.000
404 79 63 1.000
405 79 64 1.000
406 79 109 1.000
407 80 63 1.000
408 80 64 1.000
409 80 79 1.000
410 80 81 1.000
411 80 109 1.000
412 81 63 1.000
413 81 64 1.000
414 81 82 1.000
415 81 83 1.000
416 82 63 1.000
417 82 81 1.000
418 82 83 1.000
419 82 84 1.000
420 82 85 1.000
421 82 89 1.000
422 83 36 1.000
423 83 59 1.000
424 83 82 1.000
425 83 84 1.000
426 83 85 1.000
427 83 89 1.000
428 84 36 1.000
429 84 37 1.000
430 84 59 1.000
431 84 82 1.000
432 84 83 1.000
433 84 85 1.000
434 85 37 1.000
435 85 84 1.000
436 85 87 1.000
437 85 89 1.000
438 86 35 1.000
439 86 37 1.000
440 86 85 1.000
441 86 87 1.000
442 87 35 1.000
443 87 85 1.000
444 87 88 1.000
445 87 89 1.000
446 88 35 1.000
447 88 87 1.000
448 88 89 1.000
449 88 105 1.000
450 89 33 1.000
451 89 34 1.000
452 89 88 1.000
453 89 90 1.000
454 89 91 1.000
455 89 105 1.000
456 90 33 1.000
457 90 89 1.000
458 90 91 1.000
459 90 104 1.000
460 90 105 1.000
461 91 31 1.000
462 91 32 1.000
463 91 90 1.000
464 91 92 1.000
465 92 31 1.000
466 92 91 1.000
467 92 93 1.000
468 92 94 1.000
469 92 102 1.000
470 92 103 1.000
471 93 29 1.000
472 93 30 1.000
473 93 92 1.000
474 93 94 1.000
475 93 102 1.000
476 94 29 1.000
477 94 93 1.000
478 94 95 1.000
479 94 96 1.000
480 94 100 1.000
481 94 101 1.000
482 95 28 1.000
483 95 29 1.000
484 95 94 1.000
485 95 96 1.000
486 95 100 1.000
487 96 95 1.000
488 96 98 1.000
489 96 99 1.000
490 96 101 1.000
491 97 95 1.000
492 97 96 1.000
493 97 98 1.000
494 98 99 1.000
495 98 115 1.000
496 98 116 1.000
497 99 95 1.000
498 99 96 1.000
499 99 98 1.000
500 99 100 1.000
501 99 101 1.000
502 99 115 1.000
503 100 95 1.000
504 100 99 1.000
505 100 101 1.000
506 100 111 1.000
507 100 112 1.000
508 100 115 1.000
509 101 93 1.000
510 101 94 1.000
511 101 100 1.000
512 101 102 1.000
513 101 111 1.000
514 102 101 1.000
515 102 103 1.000
516 102 108 1.000
517 102 109 1.000
518 102 110 1.000
519 103 91 1.000
520 103 92 1.000
521 103 102 1.000
522 103 104 1.000
523 103 109 1.000
524 104 103 1.000
525 104 105 1.000
526 104 107 1.000
527 104 109 1.000
528 105 90 1.000
529 105 104 1.000
530 105 107 1.000
531 106 90 1.000
532 106 103 1.000
533 106 105 1.000
534 106 107 1.000
535 107 103 1.000
536 107 104 1.000
537 107 108 1.000
538 107 109 1.000
539 108 103 1.000
540 108 107 1.000
541 108 109 1.000
542 109 79 1.000
543 109 108 1.000
544 109 110 1.000
545 110 79 1.000
546 110 101 1.000
547 110 102 1.000
548 110 108 1.000
549 110 109 1.000
550 110 111 1.000
551 111 101 1.000
552 111 108 1.000
553 111 110 1.000
554 111 112 1.000
555 111 113 1.000
556 112 99 1.000
557 112 100 1.000
558 112 110 1.000
559 112 111 1.000
560 112 113 1.000
561 112 115 1.000
562 113 98 1.000
563 113 99 1.000
564 113 111 1.000
565 113 112 1.000
566 113 114 1.000
567 113 115 1.000
568 114 72 1.000
569 114 73 1.000
570 114 98 1.000
571 114 99 1.000
572 114 113 1.000
573 114 115 1.000
574 115 68 1.000
575 115 70 1.000
576 115 72 1.000
577 115 73 1.000
578 115 98 1.000
579 115 114 1.000
580 115 116 1.000
581 116 70 1.000
582 116 72 1.000
583 116 98 1.000
584 116 115 1.000
585 117 72 1.000
586 117 116 1.000
587 118 22 1.000
588 118 48 1.000
589 118 119 1.000
590 119 21 1.000
591 119 22 1.000
592 119 118 1.000
593 119 120 1.000
594 120 22 1.000
595 120 48 1.000
596 120 119 1.000
597 120 121 1.000
598 121 19 1.000
599 121 20 1.000
600 121 22 1.000
601 121 48 1.000
602 121 120 1.000
603 121 122 1.000
604 122 19 1.000
605 122 20 1.000
606 122 47 1.000
607 122 120 1.000
608 122 121 1.000
609 122 123 1.000
610 123 17 1.000
611 123 18 1.000
612 123 20 1.000
613 123 122 1.000
614 123 124 1.000
615 124 14 1.000
616 124 17 1.000
617 124 44 1.000
618 124 45 1.000
619 124 123 1.000
620 124 125 1.000
621 124 129 1.000
622 125 6 1.000
623 125 14 1.000
624 125 15 1.000
625 125 44 1.000
626 125 124 1.000
627 126 6 1.000
628 126 14 1.000
629 126 15 1.000
630 126 42 1.000
631 126 44 1.000
632 126 125 1.000
633 127 14 1.000
634 127 42 1.000
635 127 45 1.000
636 127 124 1.000
637 127 128 1.000
638 127 141 1.000
639 128 14 1.000
640 128 42 1.000
641 128 45 1.000
642 128 124 1.000
643 128 129 1.000
644 129 45 1.000
645 129 50 1.000
646 129 122 1.000
647 129 128 1.000
648 129 130 1.000
649 130 128 1.000
650 130 129 1.000
651 130 131 1.000
652 131 128 1.000
653 131 130 1.000
654 131 132 1.000
655 131 133 1.000
656 131 134 1.000
657 132 128 1.000
658 132 130 1.000
659 132 131 1.000
660 132 133 1.000
661 132 135 1.000
662 132 138 1.000
663 133 131 1.000
664 133 132 1.000
665 133 134 1.000
666 133 138 1.000
667 134 54 1.000
668 134 130 1.000
669 134 131 1.000
670 134 133 1.000
671 134 135 1.000
672 135 54 1.000
673 135 67 1.000
674 135 130 1.000
675 135 134 1.000
676 135 136 1.000
677 135 138 1.000
678 136 54 1.000
679 136 67 1.000
680 136 76 1.000
681 136 135 1.000
682 136 137 1.000
683 136 138 1.000
684 137 60 1.000
685 137 65 1.000
686 137 67 1.000
687 137 76 1.000
688 137 135 1.000
689 137 136 1.000
690 137 138 1.000
691 137 139 1.000
692 138 60 1.000
693 138 67 1.000
694 138 135 1.000
695 138 137 1.000
696 138 139 1.000
697 139 40 1.000
698 139 60 1.000
699 139 132 1.000
700 139 135 1.000
701 139 138 1.000
702 139 140 1.000
703 139 141 1.000
704 140 40 1.000
705 140 139 1.000
706 140 141 1.000
707 141 42 1.000
708 141 139 1.000
709 141 140 1.000
710 141 142 1.000
711 141 143 1.000
712 142 7 1.000
713 142 38 1.000
714 142 140 1.000
715 142 141 1.000
716 142 143 1.000
717 142 144 1.000
718 143 6 1.000
719 143 7 1.000
720 143 38 1.000
721 143 142 1.000
722 143 144 1.000
723 144 7 1.000
724 144 36 1.000
725 144 38 1.000
726 144 143 1.000
727 145 5 1.000
728 145 6 1.000
729 145 36 1.000
730 145 143 1.000
731 145 144 1.000
732 145 146 1.000
733 145 170 1.000
734 146 6 1.000
735 146 34 1.000
736 146 35 1.000
737 146 88 1.000
738 146 147 1.000
739 146 170 1.000
740 147 3 1.000
741 147 4 1.000
742 147 6 1.000
743 147 88 1.000
744 147 146 1.000
745 147 148 1.000
746 148 3 1.000
747 148 32 1.000
748 148 33 1.000
749 148 88 1.000
750 148 147 1.000
751 148 149 1.000
752 148 150 1.000
753 149 31 1.000
754 149 32 1.000
755 149 148 1.000
756 149 150 1.000
757 150 32 1.000
758 150 149 1.000
759 150 151 1.000
760 150 152 1.000
761 151 30 1.000
762 151 31 1.000
763 151 150 1.000
764 151 152 1.000
765 152 20 1.000
766 152 30 1.000
767 152 151 1.000
768 152 153 1.000
769 153 20 1.000
770 153 27 1.000
771 153 30 1.000
772 153 151 1.000
773 153 152 1.000
774 153 154 1.000
775 154 20 1.000
776 154 25 1.000
777 154 27 1.000
778 154 153 1.000
779 154 155 1.000
780 154 156 1.000
781 154 157 1.000
782 154 158 1.000
783 155 20 1.000
784 155 154 1.000
785 155 156 1.000
786 155 158 1.000
787 156 24 1.000
788 156 154 1.000
789 156 155 1.000
790 156 157 1.000
791 157 20 1.000
792 157 21 1.000
793 157 24 1.000
794 157 25 1.000
795 157 154 1.000
796 157 156 1.000
797 157 158 1.000
798 157 159 1.000
799 158 20 1.000
800 158 157 1.000
801 158 159 1.000
802 159 158 1.000
803 159 160 1.000
804 160 18 1.000
805 160 19 1.000
806 160 158 1.000
807 160 159 1.000
808 160 161 1.000
809 161 18 1.000
810 161 158 1.000
811 161 160 1.000
812 161 162 1.000
813 162 16 1.000
814 162 17 1.000
815 162 161 1.000
816 162 163 1.000
817 162 164 1.000
818 163 162 1.000
819 163 164 1.000
820 164 163 1.000
821 164 165 1.000
822 165 163 1.000
823 165 164 1.000
824 165 166 1.000
825 166 8 1.000
826 166 163 1.000
827 166 165 1.000
828 166 167 1.000
829 166 168 1.000
830 167 4 1.000
831 167 166 1.000
832 167 168 1.000
833 168 4 1.000
834 168 5 1.000
835 168 167 1.000
836 168 169 1.000
837 168 170 1.000
838 169 5 1.000
839 169 168 1.000
840 169 170 1.000
841 170 3 1.000
842 170 5 1.000
843 170 146 1.000
844 170 169 1.000