ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/src/owl/tests/core/structure/data/1oewA_BB:SC_5.0.cm
Revision: 1008
Committed: Wed Mar 31 14:03:27 2010 UTC (9 years, 6 months ago) by hstehr
File size: 24958 byte(s)
Log Message:
refactoring: adapting test packages to match new package structure
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: STGSATTTPIDSLDDAYITPVQIGTPAQTLNLDFDTGSSDLWVFSSETTASEVXQTIYTPSKSTTAKLLSGATWSISYGDGSSSSGDVYTDTVSVGGLTVTGQAVESAKKVSSSFTEDSTIDGLLGLAFSTLNTVSPTQQKTFFDNAKASLDSPVFTADLGYHAPGTYNFGFIDTTAYTGSITYTAVSTKQGFWEWTSTGYAVGSGTFKSTSIDGIADTGTTLLYLPATVVSAYWAQVSGAKSSSSVGGYVFPCSATLPSFTFGVGSARIVIPGDYIDFGPISTGSSSCFGGIQSSAGIGINIFGDVALKAAFVVFNGATTPTLGFASK
3 #PDB: 1oew
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: BB/SC
8 #CUTOFF: 5.0
9 1 2 1.000
10 1 98 1.000
11 1 151 1.000
12 1 152 1.000
13 2 1 1.000
14 2 98 1.000
15 2 151 1.000
16 2 152 1.000
17 2 172 1.000
18 3 2 1.000
19 3 4 1.000
20 3 98 1.000
21 3 169 1.000
22 3 170 1.000
23 3 172 1.000
24 4 5 1.000
25 4 169 1.000
26 5 4 1.000
27 5 6 1.000
28 5 7 1.000
29 5 19 1.000
30 5 167 1.000
31 5 168 1.000
32 5 169 1.000
33 6 5 1.000
34 6 7 1.000
35 6 8 1.000
36 6 19 1.000
37 6 20 1.000
38 7 6 1.000
39 7 8 1.000
40 7 9 1.000
41 7 17 1.000
42 7 19 1.000
43 7 165 1.000
44 8 6 1.000
45 8 7 1.000
46 8 9 1.000
47 8 10 1.000
48 8 17 1.000
49 8 18 1.000
50 9 8 1.000
51 9 10 1.000
52 9 14 1.000
53 9 17 1.000
54 10 9 1.000
55 10 11 1.000
56 10 18 1.000
57 10 120 1.000
58 11 9 1.000
59 11 10 1.000
60 11 12 1.000
61 11 14 1.000
62 12 11 1.000
63 12 13 1.000
64 12 14 1.000
65 12 163 1.000
66 13 11 1.000
67 13 12 1.000
68 13 14 1.000
69 13 15 1.000
70 13 163 1.000
71 13 279 1.000
72 13 310 1.000
73 14 9 1.000
74 14 11 1.000
75 14 13 1.000
76 14 15 1.000
77 14 17 1.000
78 14 163 1.000
79 14 222 1.000
80 14 279 1.000
81 14 306 1.000
82 14 310 1.000
83 15 10 1.000
84 15 11 1.000
85 15 13 1.000
86 15 14 1.000
87 15 16 1.000
88 15 222 1.000
89 15 279 1.000
90 15 306 1.000
91 16 9 1.000
92 16 10 1.000
93 16 11 1.000
94 16 15 1.000
95 16 17 1.000
96 16 222 1.000
97 16 306 1.000
98 17 7 1.000
99 17 10 1.000
100 17 16 1.000
101 17 18 1.000
102 17 33 1.000
103 17 306 1.000
104 18 7 1.000
105 18 8 1.000
106 18 10 1.000
107 18 17 1.000
108 18 19 1.000
109 18 20 1.000
110 19 7 1.000
111 19 18 1.000
112 19 20 1.000
113 19 21 1.000
114 19 31 1.000
115 19 32 1.000
116 19 34 1.000
117 20 5 1.000
118 20 19 1.000
119 20 21 1.000
120 20 22 1.000
121 20 29 1.000
122 20 31 1.000
123 20 34 1.000
124 20 95 1.000
125 21 20 1.000
126 21 22 1.000
127 21 23 1.000
128 21 29 1.000
129 21 30 1.000
130 21 95 1.000
131 22 21 1.000
132 22 23 1.000
133 22 27 1.000
134 22 29 1.000
135 22 93 1.000
136 22 94 1.000
137 23 21 1.000
138 23 22 1.000
139 23 27 1.000
140 23 28 1.000
141 23 58 1.000
142 23 91 1.000
143 23 93 1.000
144 24 23 1.000
145 24 25 1.000
146 24 27 1.000
147 24 58 1.000
148 24 63 1.000
149 24 65 1.000
150 24 91 1.000
151 24 92 1.000
152 25 26 1.000
153 25 63 1.000
154 25 64 1.000
155 25 65 1.000
156 25 91 1.000
157 26 25 1.000
158 26 27 1.000
159 26 28 1.000
160 27 22 1.000
161 27 26 1.000
162 27 28 1.000
163 28 22 1.000
164 28 23 1.000
165 28 27 1.000
166 28 29 1.000
167 28 30 1.000
168 29 22 1.000
169 29 28 1.000
170 29 30 1.000
171 29 56 1.000
172 30 20 1.000
173 30 21 1.000
174 30 29 1.000
175 30 31 1.000
176 30 32 1.000
177 30 56 1.000
178 30 122 1.000
179 31 18 1.000
180 31 30 1.000
181 31 32 1.000
182 31 121 1.000
183 31 122 1.000
184 32 18 1.000
185 32 19 1.000
186 32 21 1.000
187 32 31 1.000
188 32 33 1.000
189 32 34 1.000
190 33 18 1.000
191 33 32 1.000
192 33 34 1.000
193 33 35 1.000
194 33 121 1.000
195 33 124 1.000
196 33 125 1.000
197 34 33 1.000
198 34 35 1.000
199 34 125 1.000
200 34 127 1.000
201 34 168 1.000
202 34 219 1.000
203 35 33 1.000
204 35 34 1.000
205 35 36 1.000
206 35 38 1.000
207 35 127 1.000
208 35 218 1.000
209 35 219 1.000
210 36 35 1.000
211 36 127 1.000
212 36 128 1.000
213 36 194 1.000
214 36 218 1.000
215 36 219 1.000
216 37 35 1.000
217 37 36 1.000
218 37 38 1.000
219 37 128 1.000
220 37 132 1.000
221 37 193 1.000
222 37 216 1.000
223 37 218 1.000
224 38 35 1.000
225 38 39 1.000
226 38 128 1.000
227 39 38 1.000
228 39 40 1.000
229 39 106 1.000
230 39 128 1.000
231 39 132 1.000
232 39 133 1.000
233 39 142 1.000
234 40 38 1.000
235 40 39 1.000
236 40 41 1.000
237 40 42 1.000
238 40 106 1.000
239 40 124 1.000
240 40 133 1.000
241 41 40 1.000
242 41 42 1.000
243 41 105 1.000
244 41 106 1.000
245 42 32 1.000
246 42 40 1.000
247 42 41 1.000
248 42 43 1.000
249 42 74 1.000
250 42 106 1.000
251 42 124 1.000
252 43 30 1.000
253 43 42 1.000
254 43 44 1.000
255 43 45 1.000
256 43 48 1.000
257 43 107 1.000
258 43 108 1.000
259 44 30 1.000
260 44 42 1.000
261 44 43 1.000
262 44 45 1.000
263 44 48 1.000
264 44 57 1.000
265 44 58 1.000
266 44 108 1.000
267 45 44 1.000
268 45 46 1.000
269 45 47 1.000
270 45 48 1.000
271 45 53 1.000
272 45 57 1.000
273 45 58 1.000
274 45 107 1.000
275 46 45 1.000
276 46 47 1.000
277 46 57 1.000
278 46 59 1.000
279 46 60 1.000
280 47 45 1.000
281 47 46 1.000
282 47 48 1.000
283 47 107 1.000
284 47 109 1.000
285 48 45 1.000
286 48 47 1.000
287 48 49 1.000
288 48 50 1.000
289 48 53 1.000
290 49 48 1.000
291 49 50 1.000
292 49 51 1.000
293 49 52 1.000
294 49 53 1.000
295 50 49 1.000
296 50 51 1.000
297 50 53 1.000
298 51 49 1.000
299 51 50 1.000
300 51 52 1.000
301 51 116 1.000
302 52 44 1.000
303 52 48 1.000
304 52 49 1.000
305 52 51 1.000
306 52 53 1.000
307 52 55 1.000
308 52 111 1.000
309 52 116 1.000
310 53 44 1.000
311 53 48 1.000
312 53 52 1.000
313 53 55 1.000
314 53 116 1.000
315 55 53 1.000
316 55 56 1.000
317 55 57 1.000
318 55 122 1.000
319 56 30 1.000
320 56 44 1.000
321 56 55 1.000
322 56 57 1.000
323 56 122 1.000
324 57 28 1.000
325 57 30 1.000
326 57 44 1.000
327 57 56 1.000
328 57 58 1.000
329 57 59 1.000
330 58 28 1.000
331 58 30 1.000
332 58 45 1.000
333 58 46 1.000
334 58 57 1.000
335 58 59 1.000
336 58 60 1.000
337 59 28 1.000
338 59 46 1.000
339 59 58 1.000
340 59 60 1.000
341 59 61 1.000
342 59 62 1.000
343 59 63 1.000
344 60 28 1.000
345 60 46 1.000
346 60 58 1.000
347 60 59 1.000
348 60 61 1.000
349 60 63 1.000
350 60 66 1.000
351 61 59 1.000
352 61 60 1.000
353 61 62 1.000
354 62 26 1.000
355 62 28 1.000
356 62 59 1.000
357 62 61 1.000
358 62 63 1.000
359 63 28 1.000
360 63 62 1.000
361 63 64 1.000
362 63 65 1.000
363 63 66 1.000
364 63 91 1.000
365 64 25 1.000
366 64 63 1.000
367 64 65 1.000
368 65 25 1.000
369 65 63 1.000
370 65 64 1.000
371 65 66 1.000
372 65 67 1.000
373 65 91 1.000
374 66 58 1.000
375 66 63 1.000
376 66 65 1.000
377 66 67 1.000
378 66 89 1.000
379 66 91 1.000
380 67 66 1.000
381 67 68 1.000
382 67 69 1.000
383 67 89 1.000
384 67 90 1.000
385 68 67 1.000
386 68 69 1.000
387 68 70 1.000
388 68 89 1.000
389 69 68 1.000
390 69 70 1.000
391 69 72 1.000
392 69 88 1.000
393 70 68 1.000
394 70 69 1.000
395 70 72 1.000
396 71 70 1.000
397 71 72 1.000
398 71 73 1.000
399 71 137 1.000
400 72 73 1.000
401 72 87 1.000
402 72 88 1.000
403 72 135 1.000
404 72 137 1.000
405 73 72 1.000
406 73 74 1.000
407 73 88 1.000
408 73 135 1.000
409 73 136 1.000
410 74 73 1.000
411 74 75 1.000
412 74 85 1.000
413 74 88 1.000
414 74 106 1.000
415 74 134 1.000
416 74 135 1.000
417 75 74 1.000
418 75 76 1.000
419 75 85 1.000
420 75 134 1.000
421 76 74 1.000
422 76 75 1.000
423 76 77 1.000
424 76 78 1.000
425 76 83 1.000
426 76 84 1.000
427 76 134 1.000
428 77 76 1.000
429 77 78 1.000
430 77 83 1.000
431 78 77 1.000
432 78 80 1.000
433 78 82 1.000
434 79 78 1.000
435 79 80 1.000
436 80 78 1.000
437 81 80 1.000
438 81 82 1.000
439 81 83 1.000
440 82 77 1.000
441 82 78 1.000
442 82 80 1.000
443 82 83 1.000
444 82 112 1.000
445 82 114 1.000
446 82 115 1.000
447 83 77 1.000
448 83 78 1.000
449 83 82 1.000
450 83 84 1.000
451 83 111 1.000
452 83 112 1.000
453 83 115 1.000
454 84 74 1.000
455 84 75 1.000
456 84 76 1.000
457 84 83 1.000
458 84 85 1.000
459 85 74 1.000
460 85 75 1.000
461 85 84 1.000
462 85 108 1.000
463 85 109 1.000
464 85 110 1.000
465 86 73 1.000
466 86 74 1.000
467 86 85 1.000
468 86 87 1.000
469 86 109 1.000
470 87 47 1.000
471 87 74 1.000
472 87 88 1.000
473 87 106 1.000
474 87 107 1.000
475 87 109 1.000
476 88 68 1.000
477 88 69 1.000
478 88 74 1.000
479 88 87 1.000
480 88 89 1.000
481 89 69 1.000
482 89 88 1.000
483 89 90 1.000
484 89 104 1.000
485 89 105 1.000
486 90 66 1.000
487 90 67 1.000
488 90 89 1.000
489 90 91 1.000
490 91 90 1.000
491 91 92 1.000
492 91 93 1.000
493 91 103 1.000
494 91 105 1.000
495 92 23 1.000
496 92 65 1.000
497 92 91 1.000
498 92 93 1.000
499 93 92 1.000
500 93 94 1.000
501 93 99 1.000
502 93 100 1.000
503 93 103 1.000
504 93 143 1.000
505 94 21 1.000
506 94 22 1.000
507 94 93 1.000
508 94 95 1.000
509 94 99 1.000
510 94 143 1.000
511 95 5 1.000
512 95 22 1.000
513 95 94 1.000
514 95 98 1.000
515 95 143 1.000
516 96 4 1.000
517 96 5 1.000
518 96 22 1.000
519 96 95 1.000
520 97 98 1.000
521 97 99 1.000
522 98 94 1.000
523 98 95 1.000
524 98 99 1.000
525 98 143 1.000
526 99 94 1.000
527 99 98 1.000
528 99 100 1.000
529 99 150 1.000
530 100 92 1.000
531 100 93 1.000
532 100 94 1.000
533 100 99 1.000
534 100 101 1.000
535 100 103 1.000
536 100 143 1.000
537 101 92 1.000
538 101 99 1.000
539 101 100 1.000
540 101 103 1.000
541 102 90 1.000
542 102 100 1.000
543 102 101 1.000
544 102 103 1.000
545 102 146 1.000
546 103 90 1.000
547 103 91 1.000
548 103 93 1.000
549 103 100 1.000
550 103 104 1.000
551 103 105 1.000
552 103 146 1.000
553 104 41 1.000
554 104 88 1.000
555 104 90 1.000
556 104 103 1.000
557 104 105 1.000
558 104 106 1.000
559 104 140 1.000
560 104 146 1.000
561 105 41 1.000
562 105 88 1.000
563 105 89 1.000
564 105 103 1.000
565 105 104 1.000
566 105 106 1.000
567 105 107 1.000
568 106 42 1.000
569 106 43 1.000
570 106 74 1.000
571 106 88 1.000
572 106 105 1.000
573 106 107 1.000
574 107 43 1.000
575 107 45 1.000
576 107 47 1.000
577 107 74 1.000
578 107 87 1.000
579 107 106 1.000
580 107 108 1.000
581 107 109 1.000
582 108 45 1.000
583 108 47 1.000
584 108 48 1.000
585 108 74 1.000
586 108 107 1.000
587 108 109 1.000
588 109 47 1.000
589 109 48 1.000
590 109 49 1.000
591 109 52 1.000
592 109 108 1.000
593 109 110 1.000
594 110 48 1.000
595 110 49 1.000
596 110 52 1.000
597 110 84 1.000
598 110 85 1.000
599 110 108 1.000
600 110 109 1.000
601 110 111 1.000
602 111 48 1.000
603 111 52 1.000
604 111 84 1.000
605 111 110 1.000
606 111 112 1.000
607 111 116 1.000
608 112 83 1.000
609 112 84 1.000
610 112 111 1.000
611 112 113 1.000
612 112 115 1.000
613 112 116 1.000
614 113 112 1.000
615 113 114 1.000
616 113 116 1.000
617 113 117 1.000
618 114 112 1.000
619 114 113 1.000
620 114 115 1.000
621 114 117 1.000
622 114 118 1.000
623 115 44 1.000
624 115 55 1.000
625 115 111 1.000
626 115 112 1.000
627 115 114 1.000
628 115 116 1.000
629 115 118 1.000
630 116 44 1.000
631 116 55 1.000
632 116 111 1.000
633 116 115 1.000
634 116 117 1.000
635 117 55 1.000
636 117 116 1.000
637 117 118 1.000
638 118 55 1.000
639 118 117 1.000
640 118 119 1.000
641 118 120 1.000
642 118 121 1.000
643 119 55 1.000
644 119 118 1.000
645 119 120 1.000
646 119 122 1.000
647 120 10 1.000
648 120 18 1.000
649 120 31 1.000
650 120 118 1.000
651 120 119 1.000
652 120 121 1.000
653 120 122 1.000
654 121 18 1.000
655 121 44 1.000
656 121 55 1.000
657 121 118 1.000
658 121 120 1.000
659 121 122 1.000
660 122 30 1.000
661 122 32 1.000
662 122 42 1.000
663 122 43 1.000
664 122 44 1.000
665 122 55 1.000
666 122 121 1.000
667 123 32 1.000
668 123 33 1.000
669 123 42 1.000
670 123 43 1.000
671 123 44 1.000
672 123 121 1.000
673 123 122 1.000
674 123 124 1.000
675 124 32 1.000
676 124 33 1.000
677 124 41 1.000
678 124 42 1.000
679 124 125 1.000
680 125 32 1.000
681 125 34 1.000
682 125 35 1.000
683 125 41 1.000
684 125 124 1.000
685 125 127 1.000
686 126 35 1.000
687 126 38 1.000
688 126 41 1.000
689 126 124 1.000
690 126 125 1.000
691 126 127 1.000
692 126 142 1.000
693 127 36 1.000
694 127 39 1.000
695 127 128 1.000
696 127 142 1.000
697 127 156 1.000
698 127 194 1.000
699 128 36 1.000
700 128 39 1.000
701 128 127 1.000
702 128 129 1.000
703 128 130 1.000
704 128 142 1.000
705 128 194 1.000
706 129 39 1.000
707 129 128 1.000
708 129 130 1.000
709 129 131 1.000
710 129 132 1.000
711 129 142 1.000
712 129 194 1.000
713 130 39 1.000
714 130 129 1.000
715 130 131 1.000
716 130 133 1.000
717 130 139 1.000
718 130 142 1.000
719 130 145 1.000
720 131 129 1.000
721 131 130 1.000
722 131 132 1.000
723 131 139 1.000
724 132 39 1.000
725 132 40 1.000
726 132 131 1.000
727 132 133 1.000
728 132 134 1.000
729 132 139 1.000
730 133 39 1.000
731 133 40 1.000
732 133 132 1.000
733 133 134 1.000
734 133 139 1.000
735 134 40 1.000
736 134 74 1.000
737 134 133 1.000
738 134 135 1.000
739 134 136 1.000
740 135 40 1.000
741 135 74 1.000
742 135 133 1.000
743 135 134 1.000
744 135 136 1.000
745 135 139 1.000
746 136 72 1.000
747 136 73 1.000
748 136 135 1.000
749 136 137 1.000
750 137 136 1.000
751 137 138 1.000
752 138 135 1.000
753 138 137 1.000
754 138 139 1.000
755 138 140 1.000
756 139 133 1.000
757 139 135 1.000
758 139 138 1.000
759 139 140 1.000
760 140 104 1.000
761 140 130 1.000
762 140 133 1.000
763 140 135 1.000
764 140 139 1.000
765 140 141 1.000
766 141 103 1.000
767 141 104 1.000
768 141 130 1.000
769 141 140 1.000
770 141 142 1.000
771 141 145 1.000
772 141 146 1.000
773 142 103 1.000
774 142 130 1.000
775 142 141 1.000
776 142 143 1.000
777 142 145 1.000
778 142 146 1.000
779 143 100 1.000
780 143 103 1.000
781 143 142 1.000
782 143 144 1.000
783 143 146 1.000
784 143 147 1.000
785 144 127 1.000
786 144 142 1.000
787 144 143 1.000
788 144 145 1.000
789 144 147 1.000
790 144 148 1.000
791 144 151 1.000
792 144 170 1.000
793 145 141 1.000
794 145 142 1.000
795 145 144 1.000
796 145 146 1.000
797 145 148 1.000
798 146 100 1.000
799 146 141 1.000
800 146 145 1.000
801 146 147 1.000
802 146 149 1.000
803 147 100 1.000
804 147 146 1.000
805 147 148 1.000
806 147 149 1.000
807 147 150 1.000
808 147 151 1.000
809 148 147 1.000
810 148 149 1.000
811 148 151 1.000
812 148 154 1.000
813 149 148 1.000
814 149 150 1.000
815 150 1 1.000
816 150 149 1.000
817 150 151 1.000
818 150 152 1.000
819 151 1 1.000
820 151 150 1.000
821 151 152 1.000
822 152 1 1.000
823 152 2 1.000
824 152 151 1.000
825 152 153 1.000
826 153 151 1.000
827 153 152 1.000
828 153 154 1.000
829 153 155 1.000
830 154 144 1.000
831 154 148 1.000
832 154 151 1.000
833 154 153 1.000
834 154 155 1.000
835 154 317 1.000
836 155 144 1.000
837 155 151 1.000
838 155 153 1.000
839 155 154 1.000
840 155 156 1.000
841 155 170 1.000
842 156 144 1.000
843 156 155 1.000
844 156 157 1.000
845 156 170 1.000
846 156 315 1.000
847 156 316 1.000
848 157 156 1.000
849 157 158 1.000
850 157 168 1.000
851 157 169 1.000
852 157 316 1.000
853 158 156 1.000
854 158 157 1.000
855 158 159 1.000
856 158 168 1.000
857 158 313 1.000
858 158 314 1.000
859 158 316 1.000
860 159 7 1.000
861 159 158 1.000
862 159 160 1.000
863 159 167 1.000
864 159 313 1.000
865 159 329 1.000
866 160 7 1.000
867 160 17 1.000
868 160 159 1.000
869 160 310 1.000
870 160 329 1.000
871 161 9 1.000
872 161 14 1.000
873 161 17 1.000
874 161 160 1.000
875 161 162 1.000
876 161 164 1.000
877 161 310 1.000
878 161 329 1.000
879 162 14 1.000
880 162 17 1.000
881 162 163 1.000
882 162 164 1.000
883 162 276 1.000
884 162 310 1.000
885 163 9 1.000
886 163 14 1.000
887 163 17 1.000
888 163 162 1.000
889 163 164 1.000
890 164 9 1.000
891 164 14 1.000
892 164 17 1.000
893 164 163 1.000
894 164 165 1.000
895 165 6 1.000
896 165 8 1.000
897 165 9 1.000
898 165 164 1.000
899 166 6 1.000
900 166 7 1.000
901 166 165 1.000
902 166 167 1.000
903 167 7 1.000
904 167 159 1.000
905 167 168 1.000
906 168 4 1.000
907 168 5 1.000
908 168 7 1.000
909 168 167 1.000
910 168 169 1.000
911 168 170 1.000
912 169 4 1.000
913 169 156 1.000
914 169 157 1.000
915 169 167 1.000
916 169 168 1.000
917 169 170 1.000
918 169 172 1.000
919 170 2 1.000
920 170 98 1.000
921 170 151 1.000
922 170 156 1.000
923 170 169 1.000
924 170 172 1.000
925 171 2 1.000
926 171 151 1.000
927 171 152 1.000
928 171 153 1.000
929 171 155 1.000
930 171 170 1.000
931 171 172 1.000
932 172 2 1.000
933 172 155 1.000
934 172 157 1.000
935 172 169 1.000
936 172 173 1.000
937 173 155 1.000
938 173 157 1.000
939 173 172 1.000
940 173 174 1.000
941 173 175 1.000
942 173 313 1.000
943 174 169 1.000
944 174 172 1.000
945 174 173 1.000
946 174 175 1.000
947 174 176 1.000
948 174 177 1.000
949 174 178 1.000
950 174 313 1.000
951 175 173 1.000
952 175 174 1.000
953 175 176 1.000
954 175 178 1.000
955 176 174 1.000
956 176 175 1.000
957 176 177 1.000
958 177 159 1.000
959 177 174 1.000
960 177 176 1.000
961 177 178 1.000
962 177 313 1.000
963 177 329 1.000
964 178 177 1.000
965 178 179 1.000
966 178 313 1.000
967 178 329 1.000
968 179 178 1.000
969 179 327 1.000
970 179 328 1.000
971 179 329 1.000
972 180 178 1.000
973 180 179 1.000
974 180 181 1.000
975 181 178 1.000
976 181 182 1.000
977 181 183 1.000
978 181 327 1.000
979 182 178 1.000
980 182 181 1.000
981 182 183 1.000
982 182 184 1.000
983 182 327 1.000
984 183 182 1.000
985 183 184 1.000
986 183 265 1.000
987 183 326 1.000
988 184 182 1.000
989 184 183 1.000
990 184 185 1.000
991 184 265 1.000
992 185 184 1.000
993 185 186 1.000
994 185 187 1.000
995 185 323 1.000
996 185 324 1.000
997 186 185 1.000
998 186 187 1.000
999 186 196 1.000
1000 186 323 1.000
1001 187 186 1.000
1002 187 188 1.000
1003 187 196 1.000
1004 187 322 1.000
1005 188 187 1.000
1006 188 189 1.000
1007 188 195 1.000
1008 189 129 1.000
1009 189 131 1.000
1010 189 187 1.000
1011 189 188 1.000
1012 189 190 1.000
1013 190 188 1.000
1014 190 189 1.000
1015 190 191 1.000
1016 191 132 1.000
1017 191 190 1.000
1018 191 193 1.000
1019 191 195 1.000
1020 192 39 1.000
1021 192 128 1.000
1022 192 129 1.000
1023 192 131 1.000
1024 192 132 1.000
1025 192 189 1.000
1026 192 191 1.000
1027 192 193 1.000
1028 193 128 1.000
1029 193 129 1.000
1030 193 132 1.000
1031 193 187 1.000
1032 193 189 1.000
1033 193 191 1.000
1034 193 194 1.000
1035 193 195 1.000
1036 193 216 1.000
1037 194 129 1.000
1038 194 187 1.000
1039 194 193 1.000
1040 194 195 1.000
1041 194 196 1.000
1042 194 216 1.000
1043 194 217 1.000
1044 194 324 1.000
1045 195 187 1.000
1046 195 188 1.000
1047 195 193 1.000
1048 195 194 1.000
1049 195 196 1.000
1050 195 216 1.000
1051 196 195 1.000
1052 196 197 1.000
1053 196 214 1.000
1054 197 185 1.000
1055 197 196 1.000
1056 197 198 1.000
1057 197 199 1.000
1058 198 196 1.000
1059 198 197 1.000
1060 198 199 1.000
1061 198 212 1.000
1062 198 213 1.000
1063 199 198 1.000
1064 199 208 1.000
1065 199 210 1.000
1066 200 198 1.000
1067 200 199 1.000
1068 200 201 1.000
1069 200 208 1.000
1070 200 211 1.000
1071 200 213 1.000
1072 200 263 1.000
1073 201 202 1.000
1074 201 208 1.000
1075 201 209 1.000
1076 201 211 1.000
1077 201 261 1.000
1078 202 201 1.000
1079 202 203 1.000
1080 202 208 1.000
1081 202 261 1.000
1082 202 262 1.000
1083 203 201 1.000
1084 203 202 1.000
1085 203 234 1.000
1086 203 259 1.000
1087 203 261 1.000
1088 204 202 1.000
1089 204 203 1.000
1090 204 205 1.000
1091 204 259 1.000
1092 204 260 1.000
1093 204 262 1.000
1094 206 202 1.000
1095 206 205 1.000
1096 206 207 1.000
1097 207 202 1.000
1098 207 208 1.000
1099 207 209 1.000
1100 208 202 1.000
1101 208 207 1.000
1102 208 209 1.000
1103 209 201 1.000
1104 209 208 1.000
1105 209 210 1.000
1106 209 211 1.000
1107 210 208 1.000
1108 210 209 1.000
1109 210 211 1.000
1110 211 210 1.000
1111 211 212 1.000
1112 211 213 1.000
1113 212 197 1.000
1114 212 211 1.000
1115 212 213 1.000
1116 213 197 1.000
1117 213 198 1.000
1118 213 212 1.000
1119 213 214 1.000
1120 213 302 1.000
1121 213 304 1.000
1122 214 197 1.000
1123 214 213 1.000
1124 214 302 1.000
1125 215 195 1.000
1126 215 196 1.000
1127 215 214 1.000
1128 215 216 1.000
1129 215 301 1.000
1130 215 302 1.000
1131 215 304 1.000
1132 216 196 1.000
1133 216 217 1.000
1134 216 218 1.000
1135 216 303 1.000
1136 216 304 1.000
1137 217 36 1.000
1138 217 194 1.000
1139 217 196 1.000
1140 217 216 1.000
1141 217 218 1.000
1142 217 304 1.000
1143 217 309 1.000
1144 217 316 1.000
1145 218 36 1.000
1146 218 216 1.000
1147 218 217 1.000
1148 218 219 1.000
1149 218 221 1.000
1150 218 303 1.000
1151 218 306 1.000
1152 218 309 1.000
1153 219 33 1.000
1154 219 35 1.000
1155 219 36 1.000
1156 219 160 1.000
1157 219 168 1.000
1158 219 218 1.000
1159 219 306 1.000
1160 219 309 1.000
1161 220 33 1.000
1162 220 35 1.000
1163 220 36 1.000
1164 220 218 1.000
1165 220 219 1.000
1166 220 221 1.000
1167 220 306 1.000
1168 221 35 1.000
1169 221 218 1.000
1170 221 222 1.000
1171 221 306 1.000
1172 222 221 1.000
1173 222 223 1.000
1174 222 306 1.000
1175 222 307 1.000
1176 223 221 1.000
1177 223 222 1.000
1178 223 224 1.000
1179 223 225 1.000
1180 223 303 1.000
1181 223 307 1.000
1182 224 223 1.000
1183 224 225 1.000
1184 224 226 1.000
1185 224 293 1.000
1186 224 294 1.000
1187 224 307 1.000
1188 225 224 1.000
1189 225 226 1.000
1190 225 296 1.000
1191 225 302 1.000
1192 225 303 1.000
1193 226 225 1.000
1194 226 227 1.000
1195 226 231 1.000
1196 226 295 1.000
1197 226 296 1.000
1198 226 302 1.000
1199 227 226 1.000
1200 227 228 1.000
1201 227 229 1.000
1202 227 230 1.000
1203 227 231 1.000
1204 227 295 1.000
1205 227 296 1.000
1206 227 302 1.000
1207 228 227 1.000
1208 228 229 1.000
1209 228 231 1.000
1210 228 232 1.000
1211 228 250 1.000
1212 228 295 1.000
1213 229 201 1.000
1214 229 227 1.000
1215 229 228 1.000
1216 229 230 1.000
1217 229 232 1.000
1218 229 233 1.000
1219 230 201 1.000
1220 230 227 1.000
1221 230 229 1.000
1222 230 231 1.000
1223 230 233 1.000
1224 230 234 1.000
1225 230 261 1.000
1226 231 230 1.000
1227 231 232 1.000
1228 231 234 1.000
1229 231 235 1.000
1230 231 250 1.000
1231 231 293 1.000
1232 232 231 1.000
1233 232 233 1.000
1234 232 235 1.000
1235 232 236 1.000
1236 232 250 1.000
1237 233 203 1.000
1238 233 232 1.000
1239 233 234 1.000
1240 233 236 1.000
1241 233 237 1.000
1242 234 203 1.000
1243 234 233 1.000
1244 234 235 1.000
1245 234 236 1.000
1246 234 237 1.000
1247 234 238 1.000
1248 234 259 1.000
1249 235 234 1.000
1250 235 236 1.000
1251 235 238 1.000
1252 235 241 1.000
1253 236 235 1.000
1254 236 237 1.000
1255 237 236 1.000
1256 237 238 1.000
1257 237 259 1.000
1258 238 237 1.000
1259 238 239 1.000
1260 238 241 1.000
1261 239 238 1.000
1262 240 238 1.000
1263 240 239 1.000
1264 240 241 1.000
1265 240 242 1.000
1266 240 252 1.000
1267 240 253 1.000
1268 241 235 1.000
1269 241 238 1.000
1270 241 242 1.000
1271 241 252 1.000
1272 241 253 1.000
1273 242 241 1.000
1274 242 243 1.000
1275 242 244 1.000
1276 242 250 1.000
1277 242 251 1.000
1278 243 242 1.000
1279 243 244 1.000
1280 243 250 1.000
1281 244 242 1.000
1282 244 243 1.000
1283 244 245 1.000
1284 244 247 1.000
1285 244 251 1.000
1286 245 243 1.000
1287 245 244 1.000
1288 245 246 1.000
1289 246 244 1.000
1290 246 245 1.000
1291 246 247 1.000
1292 247 244 1.000
1293 247 246 1.000
1294 247 290 1.000
1295 248 244 1.000
1296 248 247 1.000
1297 248 290 1.000
1298 248 294 1.000
1299 249 243 1.000
1300 249 244 1.000
1301 249 247 1.000
1302 249 250 1.000
1303 249 251 1.000
1304 249 290 1.000
1305 249 294 1.000
1306 250 243 1.000
1307 250 251 1.000
1308 250 290 1.000
1309 250 294 1.000
1310 251 241 1.000
1311 251 242 1.000
1312 251 250 1.000
1313 251 252 1.000
1314 252 241 1.000
1315 252 251 1.000
1316 252 253 1.000
1317 252 254 1.000
1318 252 288 1.000
1319 252 289 1.000
1320 253 252 1.000
1321 253 254 1.000
1322 253 255 1.000
1323 253 256 1.000
1324 253 289 1.000
1325 254 252 1.000
1326 254 253 1.000
1327 254 255 1.000
1328 254 278 1.000
1329 254 289 1.000
1330 255 253 1.000
1331 255 254 1.000
1332 255 256 1.000
1333 255 257 1.000
1334 256 252 1.000
1335 256 253 1.000
1336 256 255 1.000
1337 256 257 1.000
1338 256 258 1.000
1339 257 256 1.000
1340 257 258 1.000
1341 257 259 1.000
1342 258 234 1.000
1343 258 256 1.000
1344 258 257 1.000
1345 258 259 1.000
1346 259 234 1.000
1347 259 258 1.000
1348 259 260 1.000
1349 259 277 1.000
1350 260 203 1.000
1351 260 234 1.000
1352 260 259 1.000
1353 260 261 1.000
1354 260 277 1.000
1355 261 234 1.000
1356 261 260 1.000
1357 261 262 1.000
1358 261 271 1.000
1359 261 272 1.000
1360 261 277 1.000
1361 262 201 1.000
1362 262 202 1.000
1363 262 208 1.000
1364 262 261 1.000
1365 262 263 1.000
1366 263 198 1.000
1367 263 201 1.000
1368 263 208 1.000
1369 263 261 1.000
1370 263 262 1.000
1371 263 265 1.000
1372 263 269 1.000
1373 263 270 1.000
1374 264 196 1.000
1375 264 198 1.000
1376 264 199 1.000
1377 264 208 1.000
1378 264 263 1.000
1379 264 265 1.000
1380 264 269 1.000
1381 265 183 1.000
1382 265 196 1.000
1383 265 198 1.000
1384 265 199 1.000
1385 265 268 1.000
1386 265 269 1.000
1387 266 183 1.000
1388 266 185 1.000
1389 266 199 1.000
1390 266 265 1.000
1391 266 267 1.000
1392 266 269 1.000
1393 267 268 1.000
1394 267 269 1.000
1395 268 183 1.000
1396 268 199 1.000
1397 268 265 1.000
1398 268 267 1.000
1399 268 269 1.000
1400 269 262 1.000
1401 269 268 1.000
1402 269 270 1.000
1403 269 271 1.000
1404 269 328 1.000
1405 270 262 1.000
1406 270 263 1.000
1407 270 269 1.000
1408 270 271 1.000
1409 270 272 1.000
1410 270 328 1.000
1411 271 262 1.000
1412 271 270 1.000
1413 271 272 1.000
1414 271 273 1.000
1415 271 311 1.000
1416 272 260 1.000
1417 272 261 1.000
1418 272 270 1.000
1419 272 271 1.000
1420 272 273 1.000
1421 272 277 1.000
1422 272 311 1.000
1423 273 260 1.000
1424 273 271 1.000
1425 273 272 1.000
1426 273 275 1.000
1427 273 276 1.000
1428 273 277 1.000
1429 274 234 1.000
1430 274 258 1.000
1431 274 260 1.000
1432 274 273 1.000
1433 274 275 1.000
1434 274 277 1.000
1435 274 278 1.000
1436 275 162 1.000
1437 275 273 1.000
1438 275 276 1.000
1439 275 278 1.000
1440 276 162 1.000
1441 276 272 1.000
1442 276 273 1.000
1443 276 275 1.000
1444 276 277 1.000
1445 276 307 1.000
1446 276 310 1.000
1447 277 235 1.000
1448 277 252 1.000
1449 277 258 1.000
1450 277 272 1.000
1451 277 276 1.000
1452 277 278 1.000
1453 277 279 1.000
1454 277 307 1.000
1455 278 252 1.000
1456 278 258 1.000
1457 278 277 1.000
1458 278 279 1.000
1459 279 13 1.000
1460 279 163 1.000
1461 279 278 1.000
1462 280 13 1.000
1463 280 278 1.000
1464 280 279 1.000
1465 280 281 1.000
1466 280 282 1.000
1467 280 289 1.000
1468 280 290 1.000
1469 281 254 1.000
1470 281 278 1.000
1471 281 282 1.000
1472 281 286 1.000
1473 281 289 1.000
1474 282 281 1.000
1475 282 283 1.000
1476 282 286 1.000
1477 283 281 1.000
1478 283 282 1.000
1479 283 284 1.000
1480 283 286 1.000
1481 284 281 1.000
1482 284 283 1.000
1483 285 281 1.000
1484 285 284 1.000
1485 285 286 1.000
1486 286 254 1.000
1487 286 281 1.000
1488 286 283 1.000
1489 286 287 1.000
1490 287 253 1.000
1491 287 254 1.000
1492 287 286 1.000
1493 287 288 1.000
1494 288 254 1.000
1495 288 281 1.000
1496 288 282 1.000
1497 288 286 1.000
1498 288 287 1.000
1499 288 289 1.000
1500 289 251 1.000
1501 289 252 1.000
1502 289 254 1.000
1503 289 278 1.000
1504 289 282 1.000
1505 289 288 1.000
1506 289 290 1.000
1507 290 251 1.000
1508 290 252 1.000
1509 290 278 1.000
1510 290 279 1.000
1511 290 282 1.000
1512 290 289 1.000
1513 290 294 1.000
1514 291 223 1.000
1515 291 235 1.000
1516 291 252 1.000
1517 291 279 1.000
1518 291 290 1.000
1519 291 294 1.000
1520 292 223 1.000
1521 292 224 1.000
1522 292 235 1.000
1523 292 277 1.000
1524 292 279 1.000
1525 292 293 1.000
1526 292 294 1.000
1527 292 307 1.000
1528 293 224 1.000
1529 293 231 1.000
1530 293 235 1.000
1531 293 250 1.000
1532 293 277 1.000
1533 293 294 1.000
1534 294 225 1.000
1535 294 226 1.000
1536 294 231 1.000
1537 294 235 1.000
1538 294 250 1.000
1539 294 293 1.000
1540 294 295 1.000
1541 295 225 1.000
1542 295 231 1.000
1543 295 294 1.000
1544 295 296 1.000
1545 296 225 1.000
1546 296 295 1.000
1547 296 297 1.000
1548 296 299 1.000
1549 296 302 1.000
1550 297 295 1.000
1551 297 296 1.000
1552 298 297 1.000
1553 298 299 1.000
1554 299 301 1.000
1555 300 299 1.000
1556 300 301 1.000
1557 301 225 1.000
1558 301 296 1.000
1559 301 299 1.000
1560 301 302 1.000
1561 301 303 1.000
1562 302 216 1.000
1563 302 296 1.000
1564 302 301 1.000
1565 302 303 1.000
1566 303 216 1.000
1567 303 224 1.000
1568 303 225 1.000
1569 303 302 1.000
1570 303 304 1.000
1571 304 217 1.000
1572 304 218 1.000
1573 304 224 1.000
1574 304 303 1.000
1575 304 308 1.000
1576 304 309 1.000
1577 305 218 1.000
1578 305 221 1.000
1579 305 224 1.000
1580 305 303 1.000
1581 305 304 1.000
1582 305 306 1.000
1583 305 307 1.000
1584 305 308 1.000
1585 305 309 1.000
1586 306 160 1.000
1587 306 307 1.000
1588 306 309 1.000
1589 306 310 1.000
1590 307 272 1.000
1591 307 276 1.000
1592 307 306 1.000
1593 307 308 1.000
1594 307 310 1.000
1595 307 311 1.000
1596 308 224 1.000
1597 308 263 1.000
1598 308 270 1.000
1599 308 272 1.000
1600 308 307 1.000
1601 308 309 1.000
1602 308 311 1.000
1603 308 312 1.000
1604 309 160 1.000
1605 309 308 1.000
1606 309 310 1.000
1607 309 312 1.000
1608 309 314 1.000
1609 309 329 1.000
1610 310 160 1.000
1611 310 276 1.000
1612 310 309 1.000
1613 310 311 1.000
1614 310 329 1.000
1615 311 270 1.000
1616 311 276 1.000
1617 311 310 1.000
1618 311 312 1.000
1619 311 329 1.000
1620 312 159 1.000
1621 312 270 1.000
1622 312 311 1.000
1623 312 313 1.000
1624 312 314 1.000
1625 312 329 1.000
1626 313 312 1.000
1627 313 314 1.000
1628 313 315 1.000
1629 313 326 1.000
1630 313 327 1.000
1631 313 329 1.000
1632 314 157 1.000
1633 314 158 1.000
1634 314 312 1.000
1635 314 313 1.000
1636 314 315 1.000
1637 314 316 1.000
1638 315 157 1.000
1639 315 184 1.000
1640 315 314 1.000
1641 315 316 1.000
1642 315 317 1.000
1643 315 324 1.000
1644 316 144 1.000
1645 316 155 1.000
1646 316 156 1.000
1647 316 194 1.000
1648 316 315 1.000
1649 316 317 1.000
1650 316 324 1.000
1651 317 155 1.000
1652 317 194 1.000
1653 317 315 1.000
1654 317 316 1.000
1655 317 322 1.000
1656 317 323 1.000
1657 318 144 1.000
1658 318 148 1.000
1659 318 154 1.000
1660 318 155 1.000
1661 318 194 1.000
1662 318 317 1.000
1663 318 319 1.000
1664 318 322 1.000
1665 319 154 1.000
1666 319 317 1.000
1667 319 320 1.000
1668 319 322 1.000
1669 320 319 1.000
1670 320 321 1.000
1671 320 322 1.000
1672 321 317 1.000
1673 321 319 1.000
1674 321 320 1.000
1675 321 322 1.000
1676 321 323 1.000
1677 322 187 1.000
1678 322 194 1.000
1679 322 317 1.000
1680 322 321 1.000
1681 322 323 1.000
1682 323 184 1.000
1683 323 187 1.000
1684 323 194 1.000
1685 323 317 1.000
1686 323 322 1.000
1687 323 324 1.000
1688 324 184 1.000
1689 324 185 1.000
1690 324 187 1.000
1691 324 323 1.000
1692 324 326 1.000
1693 325 182 1.000
1694 325 184 1.000
1695 325 314 1.000
1696 325 315 1.000
1697 325 324 1.000
1698 325 326 1.000
1699 326 182 1.000
1700 326 183 1.000
1701 326 265 1.000
1702 326 270 1.000
1703 326 327 1.000
1704 327 178 1.000
1705 327 182 1.000
1706 327 270 1.000
1707 327 312 1.000
1708 327 313 1.000
1709 327 326 1.000
1710 327 328 1.000
1711 327 329 1.000
1712 328 178 1.000
1713 328 179 1.000
1714 328 270 1.000
1715 328 313 1.000
1716 328 327 1.000
1717 328 329 1.000
1718 329 178 1.000
1719 329 179 1.000
1720 329 328 1.000