ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/src/owl/tests/core/structure/data/1oewA_BB-SC_5.0.cm
Revision: 1337
Committed: Fri Mar 11 08:47:52 2011 UTC (9 years, 7 months ago) by jmduarteg
File size: 24958 byte(s)
Log Message:
Changing file names of contact map test files, windows didn't like the ':' in the file names
Line User Rev File contents
1 duarte 884 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: STGSATTTPIDSLDDAYITPVQIGTPAQTLNLDFDTGSSDLWVFSSETTASEVXQTIYTPSKSTTAKLLSGATWSISYGDGSSSSGDVYTDTVSVGGLTVTGQAVESAKKVSSSFTEDSTIDGLLGLAFSTLNTVSPTQQKTFFDNAKASLDSPVFTADLGYHAPGTYNFGFIDTTAYTGSITYTAVSTKQGFWEWTSTGYAVGSGTFKSTSIDGIADTGTTLLYLPATVVSAYWAQVSGAKSSSSVGGYVFPCSATLPSFTFGVGSARIVIPGDYIDFGPISTGSSSCFGGIQSSAGIGINIFGDVALKAAFVVFNGATTPTLGFASK
3     #PDB: 1oew
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: BB/SC
8     #CUTOFF: 5.0
9     1 2 1.000
10     1 98 1.000
11     1 151 1.000
12     1 152 1.000
13     2 1 1.000
14     2 98 1.000
15     2 151 1.000
16     2 152 1.000
17     2 172 1.000
18     3 2 1.000
19     3 4 1.000
20     3 98 1.000
21     3 169 1.000
22     3 170 1.000
23     3 172 1.000
24     4 5 1.000
25     4 169 1.000
26     5 4 1.000
27     5 6 1.000
28     5 7 1.000
29     5 19 1.000
30     5 167 1.000
31     5 168 1.000
32     5 169 1.000
33     6 5 1.000
34     6 7 1.000
35     6 8 1.000
36     6 19 1.000
37     6 20 1.000
38     7 6 1.000
39     7 8 1.000
40     7 9 1.000
41     7 17 1.000
42     7 19 1.000
43     7 165 1.000
44     8 6 1.000
45     8 7 1.000
46     8 9 1.000
47     8 10 1.000
48     8 17 1.000
49     8 18 1.000
50     9 8 1.000
51     9 10 1.000
52     9 14 1.000
53     9 17 1.000
54     10 9 1.000
55     10 11 1.000
56     10 18 1.000
57     10 120 1.000
58     11 9 1.000
59     11 10 1.000
60     11 12 1.000
61     11 14 1.000
62     12 11 1.000
63     12 13 1.000
64     12 14 1.000
65     12 163 1.000
66     13 11 1.000
67     13 12 1.000
68     13 14 1.000
69     13 15 1.000
70     13 163 1.000
71     13 279 1.000
72     13 310 1.000
73     14 9 1.000
74     14 11 1.000
75     14 13 1.000
76     14 15 1.000
77     14 17 1.000
78     14 163 1.000
79     14 222 1.000
80     14 279 1.000
81     14 306 1.000
82     14 310 1.000
83     15 10 1.000
84     15 11 1.000
85     15 13 1.000
86     15 14 1.000
87     15 16 1.000
88     15 222 1.000
89     15 279 1.000
90     15 306 1.000
91     16 9 1.000
92     16 10 1.000
93     16 11 1.000
94     16 15 1.000
95     16 17 1.000
96     16 222 1.000
97     16 306 1.000
98     17 7 1.000
99     17 10 1.000
100     17 16 1.000
101     17 18 1.000
102     17 33 1.000
103     17 306 1.000
104     18 7 1.000
105     18 8 1.000
106     18 10 1.000
107     18 17 1.000
108     18 19 1.000
109     18 20 1.000
110     19 7 1.000
111     19 18 1.000
112     19 20 1.000
113     19 21 1.000
114     19 31 1.000
115     19 32 1.000
116     19 34 1.000
117     20 5 1.000
118     20 19 1.000
119     20 21 1.000
120     20 22 1.000
121     20 29 1.000
122     20 31 1.000
123     20 34 1.000
124     20 95 1.000
125     21 20 1.000
126     21 22 1.000
127     21 23 1.000
128     21 29 1.000
129     21 30 1.000
130     21 95 1.000
131     22 21 1.000
132     22 23 1.000
133     22 27 1.000
134     22 29 1.000
135     22 93 1.000
136     22 94 1.000
137     23 21 1.000
138     23 22 1.000
139     23 27 1.000
140     23 28 1.000
141     23 58 1.000
142     23 91 1.000
143     23 93 1.000
144     24 23 1.000
145     24 25 1.000
146     24 27 1.000
147     24 58 1.000
148     24 63 1.000
149     24 65 1.000
150     24 91 1.000
151     24 92 1.000
152     25 26 1.000
153     25 63 1.000
154     25 64 1.000
155     25 65 1.000
156     25 91 1.000
157     26 25 1.000
158     26 27 1.000
159     26 28 1.000
160     27 22 1.000
161     27 26 1.000
162     27 28 1.000
163     28 22 1.000
164     28 23 1.000
165     28 27 1.000
166     28 29 1.000
167     28 30 1.000
168     29 22 1.000
169     29 28 1.000
170     29 30 1.000
171     29 56 1.000
172     30 20 1.000
173     30 21 1.000
174     30 29 1.000
175     30 31 1.000
176     30 32 1.000
177     30 56 1.000
178     30 122 1.000
179     31 18 1.000
180     31 30 1.000
181     31 32 1.000
182     31 121 1.000
183     31 122 1.000
184     32 18 1.000
185     32 19 1.000
186     32 21 1.000
187     32 31 1.000
188     32 33 1.000
189     32 34 1.000
190     33 18 1.000
191     33 32 1.000
192     33 34 1.000
193     33 35 1.000
194     33 121 1.000
195     33 124 1.000
196     33 125 1.000
197     34 33 1.000
198     34 35 1.000
199     34 125 1.000
200     34 127 1.000
201     34 168 1.000
202     34 219 1.000
203     35 33 1.000
204     35 34 1.000
205     35 36 1.000
206     35 38 1.000
207     35 127 1.000
208     35 218 1.000
209     35 219 1.000
210     36 35 1.000
211     36 127 1.000
212     36 128 1.000
213     36 194 1.000
214     36 218 1.000
215     36 219 1.000
216     37 35 1.000
217     37 36 1.000
218     37 38 1.000
219     37 128 1.000
220     37 132 1.000
221     37 193 1.000
222     37 216 1.000
223     37 218 1.000
224     38 35 1.000
225     38 39 1.000
226     38 128 1.000
227     39 38 1.000
228     39 40 1.000
229     39 106 1.000
230     39 128 1.000
231     39 132 1.000
232     39 133 1.000
233     39 142 1.000
234     40 38 1.000
235     40 39 1.000
236     40 41 1.000
237     40 42 1.000
238     40 106 1.000
239     40 124 1.000
240     40 133 1.000
241     41 40 1.000
242     41 42 1.000
243     41 105 1.000
244     41 106 1.000
245     42 32 1.000
246     42 40 1.000
247     42 41 1.000
248     42 43 1.000
249     42 74 1.000
250     42 106 1.000
251     42 124 1.000
252     43 30 1.000
253     43 42 1.000
254     43 44 1.000
255     43 45 1.000
256     43 48 1.000
257     43 107 1.000
258     43 108 1.000
259     44 30 1.000
260     44 42 1.000
261     44 43 1.000
262     44 45 1.000
263     44 48 1.000
264     44 57 1.000
265     44 58 1.000
266     44 108 1.000
267     45 44 1.000
268     45 46 1.000
269     45 47 1.000
270     45 48 1.000
271     45 53 1.000
272     45 57 1.000
273     45 58 1.000
274     45 107 1.000
275     46 45 1.000
276     46 47 1.000
277     46 57 1.000
278     46 59 1.000
279     46 60 1.000
280     47 45 1.000
281     47 46 1.000
282     47 48 1.000
283     47 107 1.000
284     47 109 1.000
285     48 45 1.000
286     48 47 1.000
287     48 49 1.000
288     48 50 1.000
289     48 53 1.000
290     49 48 1.000
291     49 50 1.000
292     49 51 1.000
293     49 52 1.000
294     49 53 1.000
295     50 49 1.000
296     50 51 1.000
297     50 53 1.000
298     51 49 1.000
299     51 50 1.000
300     51 52 1.000
301     51 116 1.000
302     52 44 1.000
303     52 48 1.000
304     52 49 1.000
305     52 51 1.000
306     52 53 1.000
307     52 55 1.000
308     52 111 1.000
309     52 116 1.000
310     53 44 1.000
311     53 48 1.000
312     53 52 1.000
313     53 55 1.000
314     53 116 1.000
315     55 53 1.000
316     55 56 1.000
317     55 57 1.000
318     55 122 1.000
319     56 30 1.000
320     56 44 1.000
321     56 55 1.000
322     56 57 1.000
323     56 122 1.000
324     57 28 1.000
325     57 30 1.000
326     57 44 1.000
327     57 56 1.000
328     57 58 1.000
329     57 59 1.000
330     58 28 1.000
331     58 30 1.000
332     58 45 1.000
333     58 46 1.000
334     58 57 1.000
335     58 59 1.000
336     58 60 1.000
337     59 28 1.000
338     59 46 1.000
339     59 58 1.000
340     59 60 1.000
341     59 61 1.000
342     59 62 1.000
343     59 63 1.000
344     60 28 1.000
345     60 46 1.000
346     60 58 1.000
347     60 59 1.000
348     60 61 1.000
349     60 63 1.000
350     60 66 1.000
351     61 59 1.000
352     61 60 1.000
353     61 62 1.000
354     62 26 1.000
355     62 28 1.000
356     62 59 1.000
357     62 61 1.000
358     62 63 1.000
359     63 28 1.000
360     63 62 1.000
361     63 64 1.000
362     63 65 1.000
363     63 66 1.000
364     63 91 1.000
365     64 25 1.000
366     64 63 1.000
367     64 65 1.000
368     65 25 1.000
369     65 63 1.000
370     65 64 1.000
371     65 66 1.000
372     65 67 1.000
373     65 91 1.000
374     66 58 1.000
375     66 63 1.000
376     66 65 1.000
377     66 67 1.000
378     66 89 1.000
379     66 91 1.000
380     67 66 1.000
381     67 68 1.000
382     67 69 1.000
383     67 89 1.000
384     67 90 1.000
385     68 67 1.000
386     68 69 1.000
387     68 70 1.000
388     68 89 1.000
389     69 68 1.000
390     69 70 1.000
391     69 72 1.000
392     69 88 1.000
393     70 68 1.000
394     70 69 1.000
395     70 72 1.000
396     71 70 1.000
397     71 72 1.000
398     71 73 1.000
399     71 137 1.000
400     72 73 1.000
401     72 87 1.000
402     72 88 1.000
403     72 135 1.000
404     72 137 1.000
405     73 72 1.000
406     73 74 1.000
407     73 88 1.000
408     73 135 1.000
409     73 136 1.000
410     74 73 1.000
411     74 75 1.000
412     74 85 1.000
413     74 88 1.000
414     74 106 1.000
415     74 134 1.000
416     74 135 1.000
417     75 74 1.000
418     75 76 1.000
419     75 85 1.000
420     75 134 1.000
421     76 74 1.000
422     76 75 1.000
423     76 77 1.000
424     76 78 1.000
425     76 83 1.000
426     76 84 1.000
427     76 134 1.000
428     77 76 1.000
429     77 78 1.000
430     77 83 1.000
431     78 77 1.000
432     78 80 1.000
433     78 82 1.000
434     79 78 1.000
435     79 80 1.000
436     80 78 1.000
437     81 80 1.000
438     81 82 1.000
439     81 83 1.000
440     82 77 1.000
441     82 78 1.000
442     82 80 1.000
443     82 83 1.000
444     82 112 1.000
445     82 114 1.000
446     82 115 1.000
447     83 77 1.000
448     83 78 1.000
449     83 82 1.000
450     83 84 1.000
451     83 111 1.000
452     83 112 1.000
453     83 115 1.000
454     84 74 1.000
455     84 75 1.000
456     84 76 1.000
457     84 83 1.000
458     84 85 1.000
459     85 74 1.000
460     85 75 1.000
461     85 84 1.000
462     85 108 1.000
463     85 109 1.000
464     85 110 1.000
465     86 73 1.000
466     86 74 1.000
467     86 85 1.000
468     86 87 1.000
469     86 109 1.000
470     87 47 1.000
471     87 74 1.000
472     87 88 1.000
473     87 106 1.000
474     87 107 1.000
475     87 109 1.000
476     88 68 1.000
477     88 69 1.000
478     88 74 1.000
479     88 87 1.000
480     88 89 1.000
481     89 69 1.000
482     89 88 1.000
483     89 90 1.000
484     89 104 1.000
485     89 105 1.000
486     90 66 1.000
487     90 67 1.000
488     90 89 1.000
489     90 91 1.000
490     91 90 1.000
491     91 92 1.000
492     91 93 1.000
493     91 103 1.000
494     91 105 1.000
495     92 23 1.000
496     92 65 1.000
497     92 91 1.000
498     92 93 1.000
499     93 92 1.000
500     93 94 1.000
501     93 99 1.000
502     93 100 1.000
503     93 103 1.000
504     93 143 1.000
505     94 21 1.000
506     94 22 1.000
507     94 93 1.000
508     94 95 1.000
509     94 99 1.000
510     94 143 1.000
511     95 5 1.000
512     95 22 1.000
513     95 94 1.000
514     95 98 1.000
515     95 143 1.000
516     96 4 1.000
517     96 5 1.000
518     96 22 1.000
519     96 95 1.000
520     97 98 1.000
521     97 99 1.000
522     98 94 1.000
523     98 95 1.000
524     98 99 1.000
525     98 143 1.000
526     99 94 1.000
527     99 98 1.000
528     99 100 1.000
529     99 150 1.000
530     100 92 1.000
531     100 93 1.000
532     100 94 1.000
533     100 99 1.000
534     100 101 1.000
535     100 103 1.000
536     100 143 1.000
537     101 92 1.000
538     101 99 1.000
539     101 100 1.000
540     101 103 1.000
541     102 90 1.000
542     102 100 1.000
543     102 101 1.000
544     102 103 1.000
545     102 146 1.000
546     103 90 1.000
547     103 91 1.000
548     103 93 1.000
549     103 100 1.000
550     103 104 1.000
551     103 105 1.000
552     103 146 1.000
553     104 41 1.000
554     104 88 1.000
555     104 90 1.000
556     104 103 1.000
557     104 105 1.000
558     104 106 1.000
559     104 140 1.000
560     104 146 1.000
561     105 41 1.000
562     105 88 1.000
563     105 89 1.000
564     105 103 1.000
565     105 104 1.000
566     105 106 1.000
567     105 107 1.000
568     106 42 1.000
569     106 43 1.000
570     106 74 1.000
571     106 88 1.000
572     106 105 1.000
573     106 107 1.000
574     107 43 1.000
575     107 45 1.000
576     107 47 1.000
577     107 74 1.000
578     107 87 1.000
579     107 106 1.000
580     107 108 1.000
581     107 109 1.000
582     108 45 1.000
583     108 47 1.000
584     108 48 1.000
585     108 74 1.000
586     108 107 1.000
587     108 109 1.000
588     109 47 1.000
589     109 48 1.000
590     109 49 1.000
591     109 52 1.000
592     109 108 1.000
593     109 110 1.000
594     110 48 1.000
595     110 49 1.000
596     110 52 1.000
597     110 84 1.000
598     110 85 1.000
599     110 108 1.000
600     110 109 1.000
601     110 111 1.000
602     111 48 1.000
603     111 52 1.000
604     111 84 1.000
605     111 110 1.000
606     111 112 1.000
607     111 116 1.000
608     112 83 1.000
609     112 84 1.000
610     112 111 1.000
611     112 113 1.000
612     112 115 1.000
613     112 116 1.000
614     113 112 1.000
615     113 114 1.000
616     113 116 1.000
617     113 117 1.000
618     114 112 1.000
619     114 113 1.000
620     114 115 1.000
621     114 117 1.000
622     114 118 1.000
623     115 44 1.000
624     115 55 1.000
625     115 111 1.000
626     115 112 1.000
627     115 114 1.000
628     115 116 1.000
629     115 118 1.000
630     116 44 1.000
631     116 55 1.000
632     116 111 1.000
633     116 115 1.000
634     116 117 1.000
635     117 55 1.000
636     117 116 1.000
637     117 118 1.000
638     118 55 1.000
639     118 117 1.000
640     118 119 1.000
641     118 120 1.000
642     118 121 1.000
643     119 55 1.000
644     119 118 1.000
645     119 120 1.000
646     119 122 1.000
647     120 10 1.000
648     120 18 1.000
649     120 31 1.000
650     120 118 1.000
651     120 119 1.000
652     120 121 1.000
653     120 122 1.000
654     121 18 1.000
655     121 44 1.000
656     121 55 1.000
657     121 118 1.000
658     121 120 1.000
659     121 122 1.000
660     122 30 1.000
661     122 32 1.000
662     122 42 1.000
663     122 43 1.000
664     122 44 1.000
665     122 55 1.000
666     122 121 1.000
667     123 32 1.000
668     123 33 1.000
669     123 42 1.000
670     123 43 1.000
671     123 44 1.000
672     123 121 1.000
673     123 122 1.000
674     123 124 1.000
675     124 32 1.000
676     124 33 1.000
677     124 41 1.000
678     124 42 1.000
679     124 125 1.000
680     125 32 1.000
681     125 34 1.000
682     125 35 1.000
683     125 41 1.000
684     125 124 1.000
685     125 127 1.000
686     126 35 1.000
687     126 38 1.000
688     126 41 1.000
689     126 124 1.000
690     126 125 1.000
691     126 127 1.000
692     126 142 1.000
693     127 36 1.000
694     127 39 1.000
695     127 128 1.000
696     127 142 1.000
697     127 156 1.000
698     127 194 1.000
699     128 36 1.000
700     128 39 1.000
701     128 127 1.000
702     128 129 1.000
703     128 130 1.000
704     128 142 1.000
705     128 194 1.000
706     129 39 1.000
707     129 128 1.000
708     129 130 1.000
709     129 131 1.000
710     129 132 1.000
711     129 142 1.000
712     129 194 1.000
713     130 39 1.000
714     130 129 1.000
715     130 131 1.000
716     130 133 1.000
717     130 139 1.000
718     130 142 1.000
719     130 145 1.000
720     131 129 1.000
721     131 130 1.000
722     131 132 1.000
723     131 139 1.000
724     132 39 1.000
725     132 40 1.000
726     132 131 1.000
727     132 133 1.000
728     132 134 1.000
729     132 139 1.000
730     133 39 1.000
731     133 40 1.000
732     133 132 1.000
733     133 134 1.000
734     133 139 1.000
735     134 40 1.000
736     134 74 1.000
737     134 133 1.000
738     134 135 1.000
739     134 136 1.000
740     135 40 1.000
741     135 74 1.000
742     135 133 1.000
743     135 134 1.000
744     135 136 1.000
745     135 139 1.000
746     136 72 1.000
747     136 73 1.000
748     136 135 1.000
749     136 137 1.000
750     137 136 1.000
751     137 138 1.000
752     138 135 1.000
753     138 137 1.000
754     138 139 1.000
755     138 140 1.000
756     139 133 1.000
757     139 135 1.000
758     139 138 1.000
759     139 140 1.000
760     140 104 1.000
761     140 130 1.000
762     140 133 1.000
763     140 135 1.000
764     140 139 1.000
765     140 141 1.000
766     141 103 1.000
767     141 104 1.000
768     141 130 1.000
769     141 140 1.000
770     141 142 1.000
771     141 145 1.000
772     141 146 1.000
773     142 103 1.000
774     142 130 1.000
775     142 141 1.000
776     142 143 1.000
777     142 145 1.000
778     142 146 1.000
779     143 100 1.000
780     143 103 1.000
781     143 142 1.000
782     143 144 1.000
783     143 146 1.000
784     143 147 1.000
785     144 127 1.000
786     144 142 1.000
787     144 143 1.000
788     144 145 1.000
789     144 147 1.000
790     144 148 1.000
791     144 151 1.000
792     144 170 1.000
793     145 141 1.000
794     145 142 1.000
795     145 144 1.000
796     145 146 1.000
797     145 148 1.000
798     146 100 1.000
799     146 141 1.000
800     146 145 1.000
801     146 147 1.000
802     146 149 1.000
803     147 100 1.000
804     147 146 1.000
805     147 148 1.000
806     147 149 1.000
807     147 150 1.000
808     147 151 1.000
809     148 147 1.000
810     148 149 1.000
811     148 151 1.000
812     148 154 1.000
813     149 148 1.000
814     149 150 1.000
815     150 1 1.000
816     150 149 1.000
817     150 151 1.000
818     150 152 1.000
819     151 1 1.000
820     151 150 1.000
821     151 152 1.000
822     152 1 1.000
823     152 2 1.000
824     152 151 1.000
825     152 153 1.000
826     153 151 1.000
827     153 152 1.000
828     153 154 1.000
829     153 155 1.000
830     154 144 1.000
831     154 148 1.000
832     154 151 1.000
833     154 153 1.000
834     154 155 1.000
835     154 317 1.000
836     155 144 1.000
837     155 151 1.000
838     155 153 1.000
839     155 154 1.000
840     155 156 1.000
841     155 170 1.000
842     156 144 1.000
843     156 155 1.000
844     156 157 1.000
845     156 170 1.000
846     156 315 1.000
847     156 316 1.000
848     157 156 1.000
849     157 158 1.000
850     157 168 1.000
851     157 169 1.000
852     157 316 1.000
853     158 156 1.000
854     158 157 1.000
855     158 159 1.000
856     158 168 1.000
857     158 313 1.000
858     158 314 1.000
859     158 316 1.000
860     159 7 1.000
861     159 158 1.000
862     159 160 1.000
863     159 167 1.000
864     159 313 1.000
865     159 329 1.000
866     160 7 1.000
867     160 17 1.000
868     160 159 1.000
869     160 310 1.000
870     160 329 1.000
871     161 9 1.000
872     161 14 1.000
873     161 17 1.000
874     161 160 1.000
875     161 162 1.000
876     161 164 1.000
877     161 310 1.000
878     161 329 1.000
879     162 14 1.000
880     162 17 1.000
881     162 163 1.000
882     162 164 1.000
883     162 276 1.000
884     162 310 1.000
885     163 9 1.000
886     163 14 1.000
887     163 17 1.000
888     163 162 1.000
889     163 164 1.000
890     164 9 1.000
891     164 14 1.000
892     164 17 1.000
893     164 163 1.000
894     164 165 1.000
895     165 6 1.000
896     165 8 1.000
897     165 9 1.000
898     165 164 1.000
899     166 6 1.000
900     166 7 1.000
901     166 165 1.000
902     166 167 1.000
903     167 7 1.000
904     167 159 1.000
905     167 168 1.000
906     168 4 1.000
907     168 5 1.000
908     168 7 1.000
909     168 167 1.000
910     168 169 1.000
911     168 170 1.000
912     169 4 1.000
913     169 156 1.000
914     169 157 1.000
915     169 167 1.000
916     169 168 1.000
917     169 170 1.000
918     169 172 1.000
919     170 2 1.000
920     170 98 1.000
921     170 151 1.000
922     170 156 1.000
923     170 169 1.000
924     170 172 1.000
925     171 2 1.000
926     171 151 1.000
927     171 152 1.000
928     171 153 1.000
929     171 155 1.000
930     171 170 1.000
931     171 172 1.000
932     172 2 1.000
933     172 155 1.000
934     172 157 1.000
935     172 169 1.000
936     172 173 1.000
937     173 155 1.000
938     173 157 1.000
939     173 172 1.000
940     173 174 1.000
941     173 175 1.000
942     173 313 1.000
943     174 169 1.000
944     174 172 1.000
945     174 173 1.000
946     174 175 1.000
947     174 176 1.000
948     174 177 1.000
949     174 178 1.000
950     174 313 1.000
951     175 173 1.000
952     175 174 1.000
953     175 176 1.000
954     175 178 1.000
955     176 174 1.000
956     176 175 1.000
957     176 177 1.000
958     177 159 1.000
959     177 174 1.000
960     177 176 1.000
961     177 178 1.000
962     177 313 1.000
963     177 329 1.000
964     178 177 1.000
965     178 179 1.000
966     178 313 1.000
967     178 329 1.000
968     179 178 1.000
969     179 327 1.000
970     179 328 1.000
971     179 329 1.000
972     180 178 1.000
973     180 179 1.000
974     180 181 1.000
975     181 178 1.000
976     181 182 1.000
977     181 183 1.000
978     181 327 1.000
979     182 178 1.000
980     182 181 1.000
981     182 183 1.000
982     182 184 1.000
983     182 327 1.000
984     183 182 1.000
985     183 184 1.000
986     183 265 1.000
987     183 326 1.000
988     184 182 1.000
989     184 183 1.000
990     184 185 1.000
991     184 265 1.000
992     185 184 1.000
993     185 186 1.000
994     185 187 1.000
995     185 323 1.000
996     185 324 1.000
997     186 185 1.000
998     186 187 1.000
999     186 196 1.000
1000     186 323 1.000
1001     187 186 1.000
1002     187 188 1.000
1003     187 196 1.000
1004     187 322 1.000
1005     188 187 1.000
1006     188 189 1.000
1007     188 195 1.000
1008     189 129 1.000
1009     189 131 1.000
1010     189 187 1.000
1011     189 188 1.000
1012     189 190 1.000
1013     190 188 1.000
1014     190 189 1.000
1015     190 191 1.000
1016     191 132 1.000
1017     191 190 1.000
1018     191 193 1.000
1019     191 195 1.000
1020     192 39 1.000
1021     192 128 1.000
1022     192 129 1.000
1023     192 131 1.000
1024     192 132 1.000
1025     192 189 1.000
1026     192 191 1.000
1027     192 193 1.000
1028     193 128 1.000
1029     193 129 1.000
1030     193 132 1.000
1031     193 187 1.000
1032     193 189 1.000
1033     193 191 1.000
1034     193 194 1.000
1035     193 195 1.000
1036     193 216 1.000
1037     194 129 1.000
1038     194 187 1.000
1039     194 193 1.000
1040     194 195 1.000
1041     194 196 1.000
1042     194 216 1.000
1043     194 217 1.000
1044     194 324 1.000
1045     195 187 1.000
1046     195 188 1.000
1047     195 193 1.000
1048     195 194 1.000
1049     195 196 1.000
1050     195 216 1.000
1051     196 195 1.000
1052     196 197 1.000
1053     196 214 1.000
1054     197 185 1.000
1055     197 196 1.000
1056     197 198 1.000
1057     197 199 1.000
1058     198 196 1.000
1059     198 197 1.000
1060     198 199 1.000
1061     198 212 1.000
1062     198 213 1.000
1063     199 198 1.000
1064     199 208 1.000
1065     199 210 1.000
1066     200 198 1.000
1067     200 199 1.000
1068     200 201 1.000
1069     200 208 1.000
1070     200 211 1.000
1071     200 213 1.000
1072     200 263 1.000
1073     201 202 1.000
1074     201 208 1.000
1075     201 209 1.000
1076     201 211 1.000
1077     201 261 1.000
1078     202 201 1.000
1079     202 203 1.000
1080     202 208 1.000
1081     202 261 1.000
1082     202 262 1.000
1083     203 201 1.000
1084     203 202 1.000
1085     203 234 1.000
1086     203 259 1.000
1087     203 261 1.000
1088     204 202 1.000
1089     204 203 1.000
1090     204 205 1.000
1091     204 259 1.000
1092     204 260 1.000
1093     204 262 1.000
1094     206 202 1.000
1095     206 205 1.000
1096     206 207 1.000
1097     207 202 1.000
1098     207 208 1.000
1099     207 209 1.000
1100     208 202 1.000
1101     208 207 1.000
1102     208 209 1.000
1103     209 201 1.000
1104     209 208 1.000
1105     209 210 1.000
1106     209 211 1.000
1107     210 208 1.000
1108     210 209 1.000
1109     210 211 1.000
1110     211 210 1.000
1111     211 212 1.000
1112     211 213 1.000
1113     212 197 1.000
1114     212 211 1.000
1115     212 213 1.000
1116     213 197 1.000
1117     213 198 1.000
1118     213 212 1.000
1119     213 214 1.000
1120     213 302 1.000
1121     213 304 1.000
1122     214 197 1.000
1123     214 213 1.000
1124     214 302 1.000
1125     215 195 1.000
1126     215 196 1.000
1127     215 214 1.000
1128     215 216 1.000
1129     215 301 1.000
1130     215 302 1.000
1131     215 304 1.000
1132     216 196 1.000
1133     216 217 1.000
1134     216 218 1.000
1135     216 303 1.000
1136     216 304 1.000
1137     217 36 1.000
1138     217 194 1.000
1139     217 196 1.000
1140     217 216 1.000
1141     217 218 1.000
1142     217 304 1.000
1143     217 309 1.000
1144     217 316 1.000
1145     218 36 1.000
1146     218 216 1.000
1147     218 217 1.000
1148     218 219 1.000
1149     218 221 1.000
1150     218 303 1.000
1151     218 306 1.000
1152     218 309 1.000
1153     219 33 1.000
1154     219 35 1.000
1155     219 36 1.000
1156     219 160 1.000
1157     219 168 1.000
1158     219 218 1.000
1159     219 306 1.000
1160     219 309 1.000
1161     220 33 1.000
1162     220 35 1.000
1163     220 36 1.000
1164     220 218 1.000
1165     220 219 1.000
1166     220 221 1.000
1167     220 306 1.000
1168     221 35 1.000
1169     221 218 1.000
1170     221 222 1.000
1171     221 306 1.000
1172     222 221 1.000
1173     222 223 1.000
1174     222 306 1.000
1175     222 307 1.000
1176     223 221 1.000
1177     223 222 1.000
1178     223 224 1.000
1179     223 225 1.000
1180     223 303 1.000
1181     223 307 1.000
1182     224 223 1.000
1183     224 225 1.000
1184     224 226 1.000
1185     224 293 1.000
1186     224 294 1.000
1187     224 307 1.000
1188     225 224 1.000
1189     225 226 1.000
1190     225 296 1.000
1191     225 302 1.000
1192     225 303 1.000
1193     226 225 1.000
1194     226 227 1.000
1195     226 231 1.000
1196     226 295 1.000
1197     226 296 1.000
1198     226 302 1.000
1199     227 226 1.000
1200     227 228 1.000
1201     227 229 1.000
1202     227 230 1.000
1203     227 231 1.000
1204     227 295 1.000
1205     227 296 1.000
1206     227 302 1.000
1207     228 227 1.000
1208     228 229 1.000
1209     228 231 1.000
1210     228 232 1.000
1211     228 250 1.000
1212     228 295 1.000
1213     229 201 1.000
1214     229 227 1.000
1215     229 228 1.000
1216     229 230 1.000
1217     229 232 1.000
1218     229 233 1.000
1219     230 201 1.000
1220     230 227 1.000
1221     230 229 1.000
1222     230 231 1.000
1223     230 233 1.000
1224     230 234 1.000
1225     230 261 1.000
1226     231 230 1.000
1227     231 232 1.000
1228     231 234 1.000
1229     231 235 1.000
1230     231 250 1.000
1231     231 293 1.000
1232     232 231 1.000
1233     232 233 1.000
1234     232 235 1.000
1235     232 236 1.000
1236     232 250 1.000
1237     233 203 1.000
1238     233 232 1.000
1239     233 234 1.000
1240     233 236 1.000
1241     233 237 1.000
1242     234 203 1.000
1243     234 233 1.000
1244     234 235 1.000
1245     234 236 1.000
1246     234 237 1.000
1247     234 238 1.000
1248     234 259 1.000
1249     235 234 1.000
1250     235 236 1.000
1251     235 238 1.000
1252     235 241 1.000
1253     236 235 1.000
1254     236 237 1.000
1255     237 236 1.000
1256     237 238 1.000
1257     237 259 1.000
1258     238 237 1.000
1259     238 239 1.000
1260     238 241 1.000
1261     239 238 1.000
1262     240 238 1.000
1263     240 239 1.000
1264     240 241 1.000
1265     240 242 1.000
1266     240 252 1.000
1267     240 253 1.000
1268     241 235 1.000
1269     241 238 1.000
1270     241 242 1.000
1271     241 252 1.000
1272     241 253 1.000
1273     242 241 1.000
1274     242 243 1.000
1275     242 244 1.000
1276     242 250 1.000
1277     242 251 1.000
1278     243 242 1.000
1279     243 244 1.000
1280     243 250 1.000
1281     244 242 1.000
1282     244 243 1.000
1283     244 245 1.000
1284     244 247 1.000
1285     244 251 1.000
1286     245 243 1.000
1287     245 244 1.000
1288     245 246 1.000
1289     246 244 1.000
1290     246 245 1.000
1291     246 247 1.000
1292     247 244 1.000
1293     247 246 1.000
1294     247 290 1.000
1295     248 244 1.000
1296     248 247 1.000
1297     248 290 1.000
1298     248 294 1.000
1299     249 243 1.000
1300     249 244 1.000
1301     249 247 1.000
1302     249 250 1.000
1303     249 251 1.000
1304     249 290 1.000
1305     249 294 1.000
1306     250 243 1.000
1307     250 251 1.000
1308     250 290 1.000
1309     250 294 1.000
1310     251 241 1.000
1311     251 242 1.000
1312     251 250 1.000
1313     251 252 1.000
1314     252 241 1.000
1315     252 251 1.000
1316     252 253 1.000
1317     252 254 1.000
1318     252 288 1.000
1319     252 289 1.000
1320     253 252 1.000
1321     253 254 1.000
1322     253 255 1.000
1323     253 256 1.000
1324     253 289 1.000
1325     254 252 1.000
1326     254 253 1.000
1327     254 255 1.000
1328     254 278 1.000
1329     254 289 1.000
1330     255 253 1.000
1331     255 254 1.000
1332     255 256 1.000
1333     255 257 1.000
1334     256 252 1.000
1335     256 253 1.000
1336     256 255 1.000
1337     256 257 1.000
1338     256 258 1.000
1339     257 256 1.000
1340     257 258 1.000
1341     257 259 1.000
1342     258 234 1.000
1343     258 256 1.000
1344     258 257 1.000
1345     258 259 1.000
1346     259 234 1.000
1347     259 258 1.000
1348     259 260 1.000
1349     259 277 1.000
1350     260 203 1.000
1351     260 234 1.000
1352     260 259 1.000
1353     260 261 1.000
1354     260 277 1.000
1355     261 234 1.000
1356     261 260 1.000
1357     261 262 1.000
1358     261 271 1.000
1359     261 272 1.000
1360     261 277 1.000
1361     262 201 1.000
1362     262 202 1.000
1363     262 208 1.000
1364     262 261 1.000
1365     262 263 1.000
1366     263 198 1.000
1367     263 201 1.000
1368     263 208 1.000
1369     263 261 1.000
1370     263 262 1.000
1371     263 265 1.000
1372     263 269 1.000
1373     263 270 1.000
1374     264 196 1.000
1375     264 198 1.000
1376     264 199 1.000
1377     264 208 1.000
1378     264 263 1.000
1379     264 265 1.000
1380     264 269 1.000
1381     265 183 1.000
1382     265 196 1.000
1383     265 198 1.000
1384     265 199 1.000
1385     265 268 1.000
1386     265 269 1.000
1387     266 183 1.000
1388     266 185 1.000
1389     266 199 1.000
1390     266 265 1.000
1391     266 267 1.000
1392     266 269 1.000
1393     267 268 1.000
1394     267 269 1.000
1395     268 183 1.000
1396     268 199 1.000
1397     268 265 1.000
1398     268 267 1.000
1399     268 269 1.000
1400     269 262 1.000
1401     269 268 1.000
1402     269 270 1.000
1403     269 271 1.000
1404     269 328 1.000
1405     270 262 1.000
1406     270 263 1.000
1407     270 269 1.000
1408     270 271 1.000
1409     270 272 1.000
1410     270 328 1.000
1411     271 262 1.000
1412     271 270 1.000
1413     271 272 1.000
1414     271 273 1.000
1415     271 311 1.000
1416     272 260 1.000
1417     272 261 1.000
1418     272 270 1.000
1419     272 271 1.000
1420     272 273 1.000
1421     272 277 1.000
1422     272 311 1.000
1423     273 260 1.000
1424     273 271 1.000
1425     273 272 1.000
1426     273 275 1.000
1427     273 276 1.000
1428     273 277 1.000
1429     274 234 1.000
1430     274 258 1.000
1431     274 260 1.000
1432     274 273 1.000
1433     274 275 1.000
1434     274 277 1.000
1435     274 278 1.000
1436     275 162 1.000
1437     275 273 1.000
1438     275 276 1.000
1439     275 278 1.000
1440     276 162 1.000
1441     276 272 1.000
1442     276 273 1.000
1443     276 275 1.000
1444     276 277 1.000
1445     276 307 1.000
1446     276 310 1.000
1447     277 235 1.000
1448     277 252 1.000
1449     277 258 1.000
1450     277 272 1.000
1451     277 276 1.000
1452     277 278 1.000
1453     277 279 1.000
1454     277 307 1.000
1455     278 252 1.000
1456     278 258 1.000
1457     278 277 1.000
1458     278 279 1.000
1459     279 13 1.000
1460     279 163 1.000
1461     279 278 1.000
1462     280 13 1.000
1463     280 278 1.000
1464     280 279 1.000
1465     280 281 1.000
1466     280 282 1.000
1467     280 289 1.000
1468     280 290 1.000
1469     281 254 1.000
1470     281 278 1.000
1471     281 282 1.000
1472     281 286 1.000
1473     281 289 1.000
1474     282 281 1.000
1475     282 283 1.000
1476     282 286 1.000
1477     283 281 1.000
1478     283 282 1.000
1479     283 284 1.000
1480     283 286 1.000
1481     284 281 1.000
1482     284 283 1.000
1483     285 281 1.000
1484     285 284 1.000
1485     285 286 1.000
1486     286 254 1.000
1487     286 281 1.000
1488     286 283 1.000
1489     286 287 1.000
1490     287 253 1.000
1491     287 254 1.000
1492     287 286 1.000
1493     287 288 1.000
1494     288 254 1.000
1495     288 281 1.000
1496     288 282 1.000
1497     288 286 1.000
1498     288 287 1.000
1499     288 289 1.000
1500     289 251 1.000
1501     289 252 1.000
1502     289 254 1.000
1503     289 278 1.000
1504     289 282 1.000
1505     289 288 1.000
1506     289 290 1.000
1507     290 251 1.000
1508     290 252 1.000
1509     290 278 1.000
1510     290 279 1.000
1511     290 282 1.000
1512     290 289 1.000
1513     290 294 1.000
1514     291 223 1.000
1515     291 235 1.000
1516     291 252 1.000
1517     291 279 1.000
1518     291 290 1.000
1519     291 294 1.000
1520     292 223 1.000
1521     292 224 1.000
1522     292 235 1.000
1523     292 277 1.000
1524     292 279 1.000
1525     292 293 1.000
1526     292 294 1.000
1527     292 307 1.000
1528     293 224 1.000
1529     293 231 1.000
1530     293 235 1.000
1531     293 250 1.000
1532     293 277 1.000
1533     293 294 1.000
1534     294 225 1.000
1535     294 226 1.000
1536     294 231 1.000
1537     294 235 1.000
1538     294 250 1.000
1539     294 293 1.000
1540     294 295 1.000
1541     295 225 1.000
1542     295 231 1.000
1543     295 294 1.000
1544     295 296 1.000
1545     296 225 1.000
1546     296 295 1.000
1547     296 297 1.000
1548     296 299 1.000
1549     296 302 1.000
1550     297 295 1.000
1551     297 296 1.000
1552     298 297 1.000
1553     298 299 1.000
1554     299 301 1.000
1555     300 299 1.000
1556     300 301 1.000
1557     301 225 1.000
1558     301 296 1.000
1559     301 299 1.000
1560     301 302 1.000
1561     301 303 1.000
1562     302 216 1.000
1563     302 296 1.000
1564     302 301 1.000
1565     302 303 1.000
1566     303 216 1.000
1567     303 224 1.000
1568     303 225 1.000
1569     303 302 1.000
1570     303 304 1.000
1571     304 217 1.000
1572     304 218 1.000
1573     304 224 1.000
1574     304 303 1.000
1575     304 308 1.000
1576     304 309 1.000
1577     305 218 1.000
1578     305 221 1.000
1579     305 224 1.000
1580     305 303 1.000
1581     305 304 1.000
1582     305 306 1.000
1583     305 307 1.000
1584     305 308 1.000
1585     305 309 1.000
1586     306 160 1.000
1587     306 307 1.000
1588     306 309 1.000
1589     306 310 1.000
1590     307 272 1.000
1591     307 276 1.000
1592     307 306 1.000
1593     307 308 1.000
1594     307 310 1.000
1595     307 311 1.000
1596     308 224 1.000
1597     308 263 1.000
1598     308 270 1.000
1599     308 272 1.000
1600     308 307 1.000
1601     308 309 1.000
1602     308 311 1.000
1603     308 312 1.000
1604     309 160 1.000
1605     309 308 1.000
1606     309 310 1.000
1607     309 312 1.000
1608     309 314 1.000
1609     309 329 1.000
1610     310 160 1.000
1611     310 276 1.000
1612     310 309 1.000
1613     310 311 1.000
1614     310 329 1.000
1615     311 270 1.000
1616     311 276 1.000
1617     311 310 1.000
1618     311 312 1.000
1619     311 329 1.000
1620     312 159 1.000
1621     312 270 1.000
1622     312 311 1.000
1623     312 313 1.000
1624     312 314 1.000
1625     312 329 1.000
1626     313 312 1.000
1627     313 314 1.000
1628     313 315 1.000
1629     313 326 1.000
1630     313 327 1.000
1631     313 329 1.000
1632     314 157 1.000
1633     314 158 1.000
1634     314 312 1.000
1635     314 313 1.000
1636     314 315 1.000
1637     314 316 1.000
1638     315 157 1.000
1639     315 184 1.000
1640     315 314 1.000
1641     315 316 1.000
1642     315 317 1.000
1643     315 324 1.000
1644     316 144 1.000
1645     316 155 1.000
1646     316 156 1.000
1647     316 194 1.000
1648     316 315 1.000
1649     316 317 1.000
1650     316 324 1.000
1651     317 155 1.000
1652     317 194 1.000
1653     317 315 1.000
1654     317 316 1.000
1655     317 322 1.000
1656     317 323 1.000
1657     318 144 1.000
1658     318 148 1.000
1659     318 154 1.000
1660     318 155 1.000
1661     318 194 1.000
1662     318 317 1.000
1663     318 319 1.000
1664     318 322 1.000
1665     319 154 1.000
1666     319 317 1.000
1667     319 320 1.000
1668     319 322 1.000
1669     320 319 1.000
1670     320 321 1.000
1671     320 322 1.000
1672     321 317 1.000
1673     321 319 1.000
1674     321 320 1.000
1675     321 322 1.000
1676     321 323 1.000
1677     322 187 1.000
1678     322 194 1.000
1679     322 317 1.000
1680     322 321 1.000
1681     322 323 1.000
1682     323 184 1.000
1683     323 187 1.000
1684     323 194 1.000
1685     323 317 1.000
1686     323 322 1.000
1687     323 324 1.000
1688     324 184 1.000
1689     324 185 1.000
1690     324 187 1.000
1691     324 323 1.000
1692     324 326 1.000
1693     325 182 1.000
1694     325 184 1.000
1695     325 314 1.000
1696     325 315 1.000
1697     325 324 1.000
1698     325 326 1.000
1699     326 182 1.000
1700     326 183 1.000
1701     326 265 1.000
1702     326 270 1.000
1703     326 327 1.000
1704     327 178 1.000
1705     327 182 1.000
1706     327 270 1.000
1707     327 312 1.000
1708     327 313 1.000
1709     327 326 1.000
1710     327 328 1.000
1711     327 329 1.000
1712     328 178 1.000
1713     328 179 1.000
1714     328 270 1.000
1715     328 313 1.000
1716     328 327 1.000
1717     328 329 1.000
1718     329 178 1.000
1719     329 179 1.000
1720     329 328 1.000