ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/src/owl/tests/core/structure/data/2gpiA_BB-SC_5.0.cm
Revision: 1337
Committed: Fri Mar 11 08:47:52 2011 UTC (8 years, 7 months ago) by jmduarteg
File size: 5388 byte(s)
Log Message:
Changing file names of contact map test files, windows didn't like the ':' in the file names
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: GXNQSIIFTEQLTWDVQLSAIHFTAQQQGXVIDCYIGQKVLEHLAAEKINNSEQALSLFEQFRFDIEEQAEKLIEQEAFDVQGHIQVERVD
3 #PDB: 2gpi
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: BB/SC
8 #CUTOFF: 5.0
9 3 4 1.000
10 3 5 1.000
11 4 3 1.000
12 4 5 1.000
13 4 6 1.000
14 4 27 1.000
15 5 3 1.000
16 5 4 1.000
17 5 6 1.000
18 5 7 1.000
19 5 27 1.000
20 6 3 1.000
21 6 4 1.000
22 6 5 1.000
23 6 7 1.000
24 6 8 1.000
25 6 27 1.000
26 7 6 1.000
27 7 8 1.000
28 7 9 1.000
29 7 25 1.000
30 7 26 1.000
31 8 7 1.000
32 8 9 1.000
33 8 10 1.000
34 8 25 1.000
35 8 63 1.000
36 8 67 1.000
37 9 7 1.000
38 9 8 1.000
39 9 10 1.000
40 9 11 1.000
41 9 24 1.000
42 10 8 1.000
43 10 9 1.000
44 10 11 1.000
45 10 12 1.000
46 10 24 1.000
47 11 9 1.000
48 11 10 1.000
49 11 12 1.000
50 11 13 1.000
51 11 23 1.000
52 11 24 1.000
53 12 11 1.000
54 12 13 1.000
55 12 23 1.000
56 13 12 1.000
57 13 14 1.000
58 13 21 1.000
59 13 22 1.000
60 14 13 1.000
61 14 15 1.000
62 14 21 1.000
63 15 14 1.000
64 15 16 1.000
65 15 18 1.000
66 15 19 1.000
67 15 20 1.000
68 15 22 1.000
69 16 14 1.000
70 16 15 1.000
71 16 17 1.000
72 16 19 1.000
73 17 15 1.000
74 17 16 1.000
75 17 18 1.000
76 18 15 1.000
77 18 17 1.000
78 18 19 1.000
79 18 20 1.000
80 19 14 1.000
81 19 15 1.000
82 19 18 1.000
83 19 20 1.000
84 19 38 1.000
85 20 14 1.000
86 20 15 1.000
87 20 18 1.000
88 20 19 1.000
89 20 21 1.000
90 20 22 1.000
91 21 14 1.000
92 21 20 1.000
93 21 22 1.000
94 21 23 1.000
95 21 35 1.000
96 21 36 1.000
97 22 12 1.000
98 22 13 1.000
99 22 21 1.000
100 22 23 1.000
101 22 35 1.000
102 23 12 1.000
103 23 21 1.000
104 23 22 1.000
105 23 24 1.000
106 23 33 1.000
107 23 34 1.000
108 24 8 1.000
109 24 9 1.000
110 24 22 1.000
111 24 23 1.000
112 24 25 1.000
113 24 34 1.000
114 25 8 1.000
115 25 9 1.000
116 25 24 1.000
117 25 26 1.000
118 25 31 1.000
119 25 32 1.000
120 25 34 1.000
121 26 6 1.000
122 26 7 1.000
123 26 9 1.000
124 26 25 1.000
125 26 27 1.000
126 27 26 1.000
127 27 28 1.000
128 27 32 1.000
129 28 27 1.000
130 29 26 1.000
131 29 28 1.000
132 29 31 1.000
133 31 26 1.000
134 31 32 1.000
135 32 24 1.000
136 32 25 1.000
137 32 31 1.000
138 32 33 1.000
139 32 34 1.000
140 33 22 1.000
141 33 31 1.000
142 33 32 1.000
143 33 34 1.000
144 33 35 1.000
145 33 84 1.000
146 33 85 1.000
147 34 22 1.000
148 34 23 1.000
149 34 33 1.000
150 34 35 1.000
151 34 85 1.000
152 35 20 1.000
153 35 23 1.000
154 35 34 1.000
155 35 36 1.000
156 35 86 1.000
157 35 87 1.000
158 36 20 1.000
159 36 21 1.000
160 36 23 1.000
161 36 35 1.000
162 36 40 1.000
163 36 87 1.000
164 37 20 1.000
165 37 36 1.000
166 37 38 1.000
167 37 40 1.000
168 37 41 1.000
169 38 14 1.000
170 38 20 1.000
171 38 39 1.000
172 38 41 1.000
173 38 42 1.000
174 38 49 1.000
175 39 38 1.000
176 39 40 1.000
177 39 42 1.000
178 39 43 1.000
179 40 36 1.000
180 40 39 1.000
181 40 41 1.000
182 40 43 1.000
183 40 44 1.000
184 41 36 1.000
185 41 40 1.000
186 41 42 1.000
187 41 44 1.000
188 41 45 1.000
189 41 49 1.000
190 41 58 1.000
191 42 41 1.000
192 42 43 1.000
193 42 45 1.000
194 42 46 1.000
195 42 47 1.000
196 42 49 1.000
197 43 42 1.000
198 43 44 1.000
199 43 46 1.000
200 44 43 1.000
201 44 45 1.000
202 44 46 1.000
203 44 62 1.000
204 45 44 1.000
205 45 46 1.000
206 45 47 1.000
207 45 62 1.000
208 46 45 1.000
209 46 47 1.000
210 47 42 1.000
211 47 45 1.000
212 47 46 1.000
213 47 48 1.000
214 47 49 1.000
215 47 58 1.000
216 48 42 1.000
217 48 47 1.000
218 48 49 1.000
219 48 50 1.000
220 48 54 1.000
221 49 38 1.000
222 49 42 1.000
223 49 48 1.000
224 49 50 1.000
225 49 54 1.000
226 50 49 1.000
227 50 51 1.000
228 50 54 1.000
229 51 49 1.000
230 51 50 1.000
231 51 52 1.000
232 51 54 1.000
233 51 55 1.000
234 52 51 1.000
235 52 53 1.000
236 52 55 1.000
237 52 56 1.000
238 53 51 1.000
239 53 52 1.000
240 53 54 1.000
241 53 56 1.000
242 53 57 1.000
243 54 51 1.000
244 54 53 1.000
245 54 55 1.000
246 54 57 1.000
247 54 58 1.000
248 55 21 1.000
249 55 41 1.000
250 55 49 1.000
251 55 54 1.000
252 55 56 1.000
253 55 58 1.000
254 55 59 1.000
255 56 21 1.000
256 56 55 1.000
257 56 57 1.000
258 56 59 1.000
259 56 60 1.000
260 57 56 1.000
261 57 58 1.000
262 57 60 1.000
263 57 61 1.000
264 58 41 1.000
265 58 57 1.000
266 58 59 1.000
267 58 61 1.000
268 58 62 1.000
269 58 66 1.000
270 59 41 1.000
271 59 58 1.000
272 59 60 1.000
273 59 62 1.000
274 59 63 1.000
275 59 66 1.000
276 60 59 1.000
277 60 61 1.000
278 60 63 1.000
279 61 60 1.000
280 61 62 1.000
281 62 61 1.000
282 62 63 1.000
283 62 65 1.000
284 62 66 1.000
285 63 59 1.000
286 63 62 1.000
287 63 64 1.000
288 63 66 1.000
289 63 67 1.000
290 64 63 1.000
291 64 65 1.000
292 64 67 1.000
293 64 68 1.000
294 65 64 1.000
295 65 66 1.000
296 65 68 1.000
297 65 69 1.000
298 65 90 1.000
299 65 91 1.000
300 66 23 1.000
301 66 65 1.000
302 66 67 1.000
303 66 69 1.000
304 66 70 1.000
305 66 87 1.000
306 66 90 1.000
307 67 8 1.000
308 67 23 1.000
309 67 66 1.000
310 67 68 1.000
311 67 70 1.000
312 67 71 1.000
313 68 67 1.000
314 68 69 1.000
315 68 71 1.000
316 68 72 1.000
317 69 68 1.000
318 69 70 1.000
319 69 72 1.000
320 69 73 1.000
321 69 87 1.000
322 70 8 1.000
323 70 69 1.000
324 70 71 1.000
325 70 73 1.000
326 70 74 1.000
327 70 85 1.000
328 70 87 1.000
329 71 6 1.000
330 71 8 1.000
331 71 70 1.000
332 71 72 1.000
333 71 74 1.000
334 71 75 1.000
335 72 71 1.000
336 72 73 1.000
337 72 75 1.000
338 72 76 1.000
339 73 72 1.000
340 73 74 1.000
341 73 76 1.000
342 73 78 1.000
343 73 85 1.000
344 74 73 1.000
345 74 75 1.000
346 74 77 1.000
347 74 79 1.000
348 74 85 1.000
349 75 6 1.000
350 75 74 1.000
351 75 76 1.000
352 75 77 1.000
353 76 75 1.000
354 76 77 1.000
355 76 78 1.000
356 77 76 1.000
357 77 78 1.000
358 77 79 1.000
359 78 73 1.000
360 78 76 1.000
361 78 77 1.000
362 78 79 1.000
363 78 85 1.000
364 79 78 1.000
365 79 80 1.000
366 79 85 1.000
367 80 79 1.000
368 80 81 1.000
369 81 80 1.000
370 81 82 1.000
371 82 80 1.000
372 82 81 1.000
373 82 84 1.000
374 83 32 1.000
375 83 79 1.000
376 83 80 1.000
377 83 82 1.000
378 83 84 1.000
379 84 79 1.000
380 84 80 1.000
381 84 82 1.000
382 84 85 1.000
383 85 32 1.000
384 85 34 1.000
385 85 35 1.000
386 85 79 1.000
387 85 80 1.000
388 85 84 1.000
389 85 86 1.000
390 86 35 1.000
391 86 73 1.000
392 86 85 1.000
393 86 87 1.000
394 86 88 1.000
395 87 36 1.000
396 87 40 1.000
397 87 73 1.000
398 87 85 1.000
399 87 86 1.000
400 87 88 1.000
401 88 40 1.000
402 88 87 1.000
403 88 89 1.000
404 89 40 1.000
405 89 69 1.000
406 89 87 1.000
407 89 88 1.000
408 89 90 1.000
409 90 44 1.000
410 90 89 1.000
411 90 91 1.000
412 91 90 1.000