ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1d2sA_ALL_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 12297 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
3 #PDB: 1d2s
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: ALL
8 #CUTOFF: 5.0
9 1 2 1.000
10 1 3 1.000
11 1 148 1.000
12 2 3 1.000
13 2 4 1.000
14 2 147 1.000
15 2 148 1.000
16 2 149 1.000
17 3 4 1.000
18 3 5 1.000
19 3 88 1.000
20 3 146 1.000
21 3 147 1.000
22 3 148 1.000
23 3 168 1.000
24 3 169 1.000
25 3 170 1.000
26 4 5 1.000
27 4 6 1.000
28 4 15 1.000
29 4 145 1.000
30 4 146 1.000
31 4 147 1.000
32 4 167 1.000
33 4 168 1.000
34 4 169 1.000
35 4 170 1.000
36 5 6 1.000
37 5 7 1.000
38 5 15 1.000
39 5 145 1.000
40 5 146 1.000
41 5 168 1.000
42 5 169 1.000
43 5 170 1.000
44 6 7 1.000
45 6 8 1.000
46 6 15 1.000
47 6 34 1.000
48 6 43 1.000
49 6 125 1.000
50 6 126 1.000
51 6 143 1.000
52 6 145 1.000
53 6 146 1.000
54 6 147 1.000
55 7 8 1.000
56 7 9 1.000
57 7 11 1.000
58 7 15 1.000
59 7 142 1.000
60 7 143 1.000
61 7 144 1.000
62 7 145 1.000
63 8 9 1.000
64 8 10 1.000
65 8 11 1.000
66 8 15 1.000
67 8 165 1.000
68 8 166 1.000
69 8 168 1.000
70 9 10 1.000
71 9 11 1.000
72 10 11 1.000
73 10 12 1.000
74 10 142 1.000
75 11 12 1.000
76 11 13 1.000
77 11 141 1.000
78 11 142 1.000
79 12 13 1.000
80 12 14 1.000
81 13 14 1.000
82 13 15 1.000
83 13 126 1.000
84 13 127 1.000
85 13 164 1.000
86 14 15 1.000
87 14 16 1.000
88 14 17 1.000
89 14 124 1.000
90 14 125 1.000
91 14 126 1.000
92 14 127 1.000
93 14 128 1.000
94 14 129 1.000
95 14 164 1.000
96 15 16 1.000
97 15 17 1.000
98 15 125 1.000
99 15 126 1.000
100 15 162 1.000
101 15 163 1.000
102 15 164 1.000
103 15 165 1.000
104 15 167 1.000
105 16 17 1.000
106 16 18 1.000
107 16 123 1.000
108 16 124 1.000
109 16 125 1.000
110 16 162 1.000
111 16 163 1.000
112 16 164 1.000
113 16 167 1.000
114 17 18 1.000
115 17 19 1.000
116 17 122 1.000
117 17 123 1.000
118 17 124 1.000
119 17 129 1.000
120 17 160 1.000
121 17 161 1.000
122 17 162 1.000
123 17 163 1.000
124 18 19 1.000
125 18 20 1.000
126 18 121 1.000
127 18 122 1.000
128 18 123 1.000
129 18 125 1.000
130 18 152 1.000
131 18 158 1.000
132 18 160 1.000
133 18 161 1.000
134 19 20 1.000
135 19 21 1.000
136 19 120 1.000
137 19 121 1.000
138 19 122 1.000
139 19 157 1.000
140 19 158 1.000
141 19 159 1.000
142 19 160 1.000
143 19 161 1.000
144 20 21 1.000
145 20 22 1.000
146 20 25 1.000
147 20 119 1.000
148 20 120 1.000
149 20 121 1.000
150 20 122 1.000
151 20 123 1.000
152 20 152 1.000
153 20 153 1.000
154 20 154 1.000
155 20 155 1.000
156 20 157 1.000
157 20 158 1.000
158 20 159 1.000
159 21 22 1.000
160 21 23 1.000
161 21 24 1.000
162 21 25 1.000
163 21 119 1.000
164 21 120 1.000
165 21 157 1.000
166 21 158 1.000
167 21 159 1.000
168 22 23 1.000
169 22 24 1.000
170 22 25 1.000
171 22 48 1.000
172 22 118 1.000
173 22 119 1.000
174 22 120 1.000
175 22 121 1.000
176 23 24 1.000
177 23 25 1.000
178 23 119 1.000
179 24 25 1.000
180 24 26 1.000
181 24 154 1.000
182 24 156 1.000
183 24 157 1.000
184 25 26 1.000
185 25 27 1.000
186 25 28 1.000
187 25 121 1.000
188 25 153 1.000
189 25 154 1.000
190 25 157 1.000
191 26 27 1.000
192 26 28 1.000
193 26 154 1.000
194 27 28 1.000
195 27 29 1.000
196 27 151 1.000
197 27 153 1.000
198 27 154 1.000
199 28 29 1.000
200 28 30 1.000
201 28 93 1.000
202 28 94 1.000
203 28 95 1.000
204 28 153 1.000
205 29 30 1.000
206 29 31 1.000
207 29 93 1.000
208 29 94 1.000
209 29 95 1.000
210 29 151 1.000
211 29 152 1.000
212 29 153 1.000
213 30 31 1.000
214 30 32 1.000
215 30 44 1.000
216 30 91 1.000
217 30 92 1.000
218 30 93 1.000
219 30 151 1.000
220 30 152 1.000
221 30 153 1.000
222 31 32 1.000
223 31 33 1.000
224 31 91 1.000
225 31 92 1.000
226 31 93 1.000
227 31 149 1.000
228 31 150 1.000
229 31 151 1.000
230 32 33 1.000
231 32 34 1.000
232 32 43 1.000
233 32 44 1.000
234 32 57 1.000
235 32 89 1.000
236 32 90 1.000
237 32 91 1.000
238 32 147 1.000
239 32 148 1.000
240 32 149 1.000
241 32 150 1.000
242 32 152 1.000
243 33 34 1.000
244 33 35 1.000
245 33 88 1.000
246 33 89 1.000
247 33 90 1.000
248 33 91 1.000
249 33 146 1.000
250 33 147 1.000
251 33 148 1.000
252 33 149 1.000
253 34 35 1.000
254 34 36 1.000
255 34 43 1.000
256 34 83 1.000
257 34 87 1.000
258 34 88 1.000
259 34 89 1.000
260 34 91 1.000
261 34 146 1.000
262 34 147 1.000
263 35 36 1.000
264 35 37 1.000
265 35 86 1.000
266 35 87 1.000
267 35 88 1.000
268 35 144 1.000
269 35 145 1.000
270 35 146 1.000
271 36 37 1.000
272 36 38 1.000
273 36 59 1.000
274 36 83 1.000
275 36 84 1.000
276 36 85 1.000
277 36 86 1.000
278 36 87 1.000
279 36 143 1.000
280 36 144 1.000
281 36 145 1.000
282 37 38 1.000
283 37 39 1.000
284 37 84 1.000
285 37 85 1.000
286 37 86 1.000
287 37 144 1.000
288 38 39 1.000
289 38 40 1.000
290 38 59 1.000
291 38 84 1.000
292 38 142 1.000
293 38 143 1.000
294 38 144 1.000
295 39 40 1.000
296 39 41 1.000
297 39 59 1.000
298 39 60 1.000
299 39 61 1.000
300 39 62 1.000
301 39 63 1.000
302 39 82 1.000
303 39 84 1.000
304 40 41 1.000
305 40 42 1.000
306 40 59 1.000
307 40 60 1.000
308 40 62 1.000
309 40 139 1.000
310 40 140 1.000
311 40 141 1.000
312 40 142 1.000
313 40 143 1.000
314 41 42 1.000
315 41 43 1.000
316 41 57 1.000
317 41 58 1.000
318 41 59 1.000
319 41 139 1.000
320 41 140 1.000
321 41 141 1.000
322 41 142 1.000
323 41 143 1.000
324 42 43 1.000
325 42 44 1.000
326 42 45 1.000
327 42 56 1.000
328 42 57 1.000
329 42 58 1.000
330 42 126 1.000
331 42 127 1.000
332 42 128 1.000
333 42 139 1.000
334 42 140 1.000
335 42 141 1.000
336 42 142 1.000
337 42 143 1.000
338 43 44 1.000
339 43 45 1.000
340 43 57 1.000
341 43 58 1.000
342 43 59 1.000
343 43 124 1.000
344 43 125 1.000
345 43 126 1.000
346 43 127 1.000
347 43 143 1.000
348 43 147 1.000
349 44 45 1.000
350 44 46 1.000
351 44 55 1.000
352 44 56 1.000
353 44 57 1.000
354 44 93 1.000
355 44 123 1.000
356 44 124 1.000
357 44 125 1.000
358 44 126 1.000
359 44 127 1.000
360 44 152 1.000
361 45 46 1.000
362 45 47 1.000
363 45 49 1.000
364 45 50 1.000
365 45 54 1.000
366 45 55 1.000
367 45 56 1.000
368 45 57 1.000
369 45 122 1.000
370 45 123 1.000
371 45 124 1.000
372 45 127 1.000
373 45 128 1.000
374 45 129 1.000
375 45 130 1.000
376 46 47 1.000
377 46 48 1.000
378 46 53 1.000
379 46 54 1.000
380 46 55 1.000
381 46 56 1.000
382 46 122 1.000
383 46 123 1.000
384 46 124 1.000
385 47 48 1.000
386 47 49 1.000
387 47 50 1.000
388 47 53 1.000
389 47 54 1.000
390 47 55 1.000
391 47 120 1.000
392 47 121 1.000
393 47 122 1.000
394 47 129 1.000
395 48 49 1.000
396 48 50 1.000
397 48 53 1.000
398 48 118 1.000
399 48 120 1.000
400 48 121 1.000
401 49 50 1.000
402 49 51 1.000
403 49 52 1.000
404 49 53 1.000
405 49 54 1.000
406 50 51 1.000
407 50 52 1.000
408 50 54 1.000
409 50 122 1.000
410 50 129 1.000
411 50 130 1.000
412 51 52 1.000
413 51 53 1.000
414 51 54 1.000
415 51 69 1.000
416 52 53 1.000
417 52 54 1.000
418 52 69 1.000
419 52 70 1.000
420 52 71 1.000
421 53 54 1.000
422 53 55 1.000
423 53 69 1.000
424 53 70 1.000
425 53 71 1.000
426 53 118 1.000
427 54 55 1.000
428 54 56 1.000
429 54 67 1.000
430 54 68 1.000
431 54 69 1.000
432 54 70 1.000
433 54 130 1.000
434 54 134 1.000
435 54 135 1.000
436 54 136 1.000
437 55 56 1.000
438 55 57 1.000
439 55 66 1.000
440 55 67 1.000
441 55 68 1.000
442 55 69 1.000
443 55 93 1.000
444 55 100 1.000
445 56 57 1.000
446 56 58 1.000
447 56 65 1.000
448 56 66 1.000
449 56 67 1.000
450 56 68 1.000
451 56 128 1.000
452 56 135 1.000
453 56 139 1.000
454 57 58 1.000
455 57 59 1.000
456 57 64 1.000
457 57 65 1.000
458 57 66 1.000
459 57 91 1.000
460 57 93 1.000
461 57 102 1.000
462 58 59 1.000
463 58 60 1.000
464 58 63 1.000
465 58 64 1.000
466 58 65 1.000
467 59 60 1.000
468 59 61 1.000
469 59 62 1.000
470 59 63 1.000
471 59 64 1.000
472 59 65 1.000
473 59 83 1.000
474 59 84 1.000
475 59 139 1.000
476 59 143 1.000
477 60 61 1.000
478 60 62 1.000
479 60 63 1.000
480 60 64 1.000
481 60 65 1.000
482 60 67 1.000
483 60 137 1.000
484 60 138 1.000
485 60 139 1.000
486 61 62 1.000
487 61 63 1.000
488 61 82 1.000
489 61 84 1.000
490 62 63 1.000
491 62 64 1.000
492 62 81 1.000
493 62 82 1.000
494 62 83 1.000
495 62 84 1.000
496 63 64 1.000
497 63 65 1.000
498 63 79 1.000
499 63 80 1.000
500 63 81 1.000
501 63 82 1.000
502 63 83 1.000
503 64 65 1.000
504 64 66 1.000
505 64 77 1.000
506 64 78 1.000
507 64 79 1.000
508 64 80 1.000
509 64 81 1.000
510 64 83 1.000
511 64 102 1.000
512 64 104 1.000
513 65 66 1.000
514 65 67 1.000
515 65 76 1.000
516 65 77 1.000
517 65 78 1.000
518 65 137 1.000
519 65 139 1.000
520 66 67 1.000
521 66 68 1.000
522 66 75 1.000
523 66 76 1.000
524 66 77 1.000
525 66 78 1.000
526 66 100 1.000
527 66 102 1.000
528 66 110 1.000
529 66 112 1.000
530 67 68 1.000
531 67 69 1.000
532 67 75 1.000
533 67 76 1.000
534 67 135 1.000
535 67 136 1.000
536 67 137 1.000
537 67 138 1.000
538 67 139 1.000
539 68 69 1.000
540 68 70 1.000
541 68 73 1.000
542 68 74 1.000
543 68 75 1.000
544 68 100 1.000
545 68 112 1.000
546 68 115 1.000
547 68 136 1.000
548 69 70 1.000
549 69 71 1.000
550 69 73 1.000
551 69 74 1.000
552 69 136 1.000
553 70 71 1.000
554 70 72 1.000
555 70 73 1.000
556 70 74 1.000
557 70 115 1.000
558 70 116 1.000
559 71 72 1.000
560 71 73 1.000
561 71 74 1.000
562 72 73 1.000
563 72 74 1.000
564 72 114 1.000
565 72 115 1.000
566 72 116 1.000
567 72 117 1.000
568 73 74 1.000
569 73 75 1.000
570 73 114 1.000
571 73 115 1.000
572 74 75 1.000
573 74 76 1.000
574 74 136 1.000
575 75 76 1.000
576 75 77 1.000
577 75 112 1.000
578 75 115 1.000
579 75 136 1.000
580 76 77 1.000
581 76 78 1.000
582 76 136 1.000
583 76 137 1.000
584 77 78 1.000
585 77 79 1.000
586 77 110 1.000
587 77 112 1.000
588 78 79 1.000
589 78 80 1.000
590 79 80 1.000
591 79 81 1.000
592 79 109 1.000
593 79 110 1.000
594 80 81 1.000
595 80 82 1.000
596 80 109 1.000
597 81 82 1.000
598 81 83 1.000
599 81 104 1.000
600 81 107 1.000
601 81 109 1.000
602 82 83 1.000
603 82 84 1.000
604 82 85 1.000
605 82 89 1.000
606 83 84 1.000
607 83 85 1.000
608 83 86 1.000
609 83 87 1.000
610 83 89 1.000
611 83 91 1.000
612 83 104 1.000
613 84 85 1.000
614 84 86 1.000
615 85 86 1.000
616 85 87 1.000
617 85 89 1.000
618 86 87 1.000
619 86 88 1.000
620 87 88 1.000
621 87 89 1.000
622 87 105 1.000
623 88 89 1.000
624 88 90 1.000
625 88 105 1.000
626 88 146 1.000
627 88 147 1.000
628 88 148 1.000
629 89 90 1.000
630 89 91 1.000
631 89 104 1.000
632 89 105 1.000
633 90 91 1.000
634 90 92 1.000
635 90 103 1.000
636 90 104 1.000
637 90 105 1.000
638 90 106 1.000
639 90 149 1.000
640 91 92 1.000
641 91 93 1.000
642 91 102 1.000
643 91 103 1.000
644 91 104 1.000
645 91 105 1.000
646 92 93 1.000
647 92 94 1.000
648 92 101 1.000
649 92 102 1.000
650 92 103 1.000
651 93 94 1.000
652 93 95 1.000
653 93 100 1.000
654 93 101 1.000
655 93 102 1.000
656 94 95 1.000
657 94 96 1.000
658 94 99 1.000
659 94 100 1.000
660 94 101 1.000
661 94 103 1.000
662 95 96 1.000
663 95 97 1.000
664 95 99 1.000
665 95 100 1.000
666 95 116 1.000
667 96 97 1.000
668 96 98 1.000
669 96 99 1.000
670 96 100 1.000
671 96 101 1.000
672 96 111 1.000
673 97 98 1.000
674 97 99 1.000
675 97 116 1.000
676 98 99 1.000
677 98 100 1.000
678 98 112 1.000
679 98 113 1.000
680 98 114 1.000
681 98 115 1.000
682 98 116 1.000
683 99 100 1.000
684 99 101 1.000
685 99 111 1.000
686 99 112 1.000
687 99 113 1.000
688 99 114 1.000
689 99 115 1.000
690 100 101 1.000
691 100 102 1.000
692 100 110 1.000
693 100 111 1.000
694 100 112 1.000
695 100 115 1.000
696 101 102 1.000
697 101 103 1.000
698 101 108 1.000
699 101 110 1.000
700 101 111 1.000
701 101 112 1.000
702 102 103 1.000
703 102 104 1.000
704 102 107 1.000
705 102 108 1.000
706 102 109 1.000
707 102 110 1.000
708 103 104 1.000
709 103 105 1.000
710 103 106 1.000
711 103 107 1.000
712 103 108 1.000
713 103 109 1.000
714 104 105 1.000
715 104 106 1.000
716 104 107 1.000
717 104 108 1.000
718 104 109 1.000
719 105 106 1.000
720 105 107 1.000
721 106 107 1.000
722 106 108 1.000
723 107 108 1.000
724 107 109 1.000
725 108 109 1.000
726 108 110 1.000
727 108 111 1.000
728 109 110 1.000
729 109 111 1.000
730 110 111 1.000
731 110 112 1.000
732 111 112 1.000
733 111 113 1.000
734 112 113 1.000
735 112 114 1.000
736 112 115 1.000
737 113 114 1.000
738 113 115 1.000
739 114 115 1.000
740 114 116 1.000
741 115 116 1.000
742 115 117 1.000
743 116 117 1.000
744 118 119 1.000
745 118 120 1.000
746 119 120 1.000
747 119 121 1.000
748 120 121 1.000
749 120 122 1.000
750 120 159 1.000
751 121 122 1.000
752 121 123 1.000
753 121 153 1.000
754 122 123 1.000
755 122 124 1.000
756 122 129 1.000
757 123 124 1.000
758 123 125 1.000
759 123 152 1.000
760 123 153 1.000
761 124 125 1.000
762 124 126 1.000
763 124 127 1.000
764 124 128 1.000
765 124 129 1.000
766 125 126 1.000
767 125 127 1.000
768 125 147 1.000
769 125 150 1.000
770 125 152 1.000
771 126 127 1.000
772 126 128 1.000
773 126 141 1.000
774 127 128 1.000
775 127 129 1.000
776 127 141 1.000
777 128 129 1.000
778 128 130 1.000
779 128 131 1.000
780 128 132 1.000
781 128 135 1.000
782 128 141 1.000
783 129 130 1.000
784 129 131 1.000
785 130 131 1.000
786 130 132 1.000
787 130 134 1.000
788 130 135 1.000
789 131 132 1.000
790 131 133 1.000
791 131 134 1.000
792 131 135 1.000
793 132 133 1.000
794 132 134 1.000
795 132 135 1.000
796 132 138 1.000
797 132 139 1.000
798 132 141 1.000
799 133 134 1.000
800 133 135 1.000
801 133 138 1.000
802 134 135 1.000
803 134 136 1.000
804 135 136 1.000
805 135 137 1.000
806 135 138 1.000
807 135 139 1.000
808 136 137 1.000
809 136 138 1.000
810 137 138 1.000
811 137 139 1.000
812 138 139 1.000
813 138 140 1.000
814 139 140 1.000
815 139 141 1.000
816 140 141 1.000
817 140 142 1.000
818 141 142 1.000
819 141 143 1.000
820 142 143 1.000
821 142 144 1.000
822 143 144 1.000
823 143 145 1.000
824 144 145 1.000
825 144 146 1.000
826 145 146 1.000
827 145 147 1.000
828 145 170 1.000
829 146 147 1.000
830 146 148 1.000
831 146 170 1.000
832 147 148 1.000
833 147 149 1.000
834 147 150 1.000
835 147 152 1.000
836 148 149 1.000
837 148 150 1.000
838 149 150 1.000
839 149 151 1.000
840 150 151 1.000
841 150 152 1.000
842 151 152 1.000
843 151 153 1.000
844 152 153 1.000
845 152 154 1.000
846 152 155 1.000
847 153 154 1.000
848 153 155 1.000
849 154 155 1.000
850 154 156 1.000
851 154 157 1.000
852 154 158 1.000
853 155 156 1.000
854 155 157 1.000
855 155 158 1.000
856 156 157 1.000
857 156 158 1.000
858 157 158 1.000
859 157 159 1.000
860 158 159 1.000
861 158 160 1.000
862 158 161 1.000
863 159 160 1.000
864 159 161 1.000
865 160 161 1.000
866 160 162 1.000
867 161 162 1.000
868 161 163 1.000
869 162 163 1.000
870 162 164 1.000
871 163 164 1.000
872 163 165 1.000
873 163 166 1.000
874 163 167 1.000
875 164 165 1.000
876 164 166 1.000
877 165 166 1.000
878 165 167 1.000
879 166 167 1.000
880 166 168 1.000
881 167 168 1.000
882 167 169 1.000
883 168 169 1.000
884 168 170 1.000
885 169 170 1.000