ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1d2sA_BB_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 4 months ago) by duarte
File size: 9372 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line User Rev File contents
1 duarte 884 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
3     #PDB: 1d2s
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: BB
8     #CUTOFF: 5.0
9     1 2 1.000
10     1 3 1.000
11     2 3 1.000
12     2 4 1.000
13     2 147 1.000
14     2 148 1.000
15     2 149 1.000
16     3 4 1.000
17     3 5 1.000
18     3 147 1.000
19     3 148 1.000
20     3 168 1.000
21     3 169 1.000
22     3 170 1.000
23     4 5 1.000
24     4 6 1.000
25     4 145 1.000
26     4 146 1.000
27     4 147 1.000
28     4 168 1.000
29     4 169 1.000
30     4 170 1.000
31     5 6 1.000
32     5 7 1.000
33     5 145 1.000
34     5 146 1.000
35     5 168 1.000
36     5 169 1.000
37     5 170 1.000
38     6 7 1.000
39     6 8 1.000
40     6 125 1.000
41     6 126 1.000
42     6 143 1.000
43     6 145 1.000
44     6 146 1.000
45     7 8 1.000
46     7 9 1.000
47     7 11 1.000
48     7 143 1.000
49     7 145 1.000
50     8 9 1.000
51     8 10 1.000
52     8 11 1.000
53     9 10 1.000
54     9 11 1.000
55     10 11 1.000
56     10 12 1.000
57     11 12 1.000
58     11 13 1.000
59     11 141 1.000
60     11 142 1.000
61     12 13 1.000
62     12 14 1.000
63     13 14 1.000
64     13 15 1.000
65     13 126 1.000
66     13 127 1.000
67     14 15 1.000
68     14 16 1.000
69     14 125 1.000
70     14 126 1.000
71     14 127 1.000
72     14 128 1.000
73     14 164 1.000
74     15 16 1.000
75     15 17 1.000
76     15 125 1.000
77     15 126 1.000
78     15 162 1.000
79     15 163 1.000
80     15 164 1.000
81     15 165 1.000
82     16 17 1.000
83     16 18 1.000
84     16 123 1.000
85     16 124 1.000
86     16 125 1.000
87     16 162 1.000
88     16 163 1.000
89     17 18 1.000
90     17 19 1.000
91     17 123 1.000
92     17 124 1.000
93     17 160 1.000
94     17 161 1.000
95     17 162 1.000
96     17 163 1.000
97     18 19 1.000
98     18 20 1.000
99     18 121 1.000
100     18 122 1.000
101     18 123 1.000
102     18 160 1.000
103     18 161 1.000
104     19 20 1.000
105     19 21 1.000
106     19 121 1.000
107     19 122 1.000
108     19 157 1.000
109     19 158 1.000
110     19 159 1.000
111     19 160 1.000
112     19 161 1.000
113     20 21 1.000
114     20 22 1.000
115     20 119 1.000
116     20 120 1.000
117     20 121 1.000
118     20 122 1.000
119     20 157 1.000
120     20 158 1.000
121     20 159 1.000
122     21 22 1.000
123     21 23 1.000
124     21 24 1.000
125     21 25 1.000
126     21 119 1.000
127     21 120 1.000
128     21 157 1.000
129     21 158 1.000
130     21 159 1.000
131     22 23 1.000
132     22 24 1.000
133     22 25 1.000
134     22 118 1.000
135     22 119 1.000
136     22 120 1.000
137     22 121 1.000
138     23 24 1.000
139     23 25 1.000
140     23 119 1.000
141     24 25 1.000
142     24 26 1.000
143     24 157 1.000
144     25 26 1.000
145     25 27 1.000
146     26 27 1.000
147     26 28 1.000
148     27 28 1.000
149     27 29 1.000
150     27 153 1.000
151     27 154 1.000
152     28 29 1.000
153     28 30 1.000
154     28 93 1.000
155     28 94 1.000
156     28 95 1.000
157     29 30 1.000
158     29 31 1.000
159     29 93 1.000
160     29 94 1.000
161     29 95 1.000
162     29 151 1.000
163     29 152 1.000
164     29 153 1.000
165     30 31 1.000
166     30 32 1.000
167     30 91 1.000
168     30 92 1.000
169     30 93 1.000
170     30 151 1.000
171     30 152 1.000
172     30 153 1.000
173     31 32 1.000
174     31 33 1.000
175     31 91 1.000
176     31 92 1.000
177     31 93 1.000
178     31 149 1.000
179     31 150 1.000
180     31 151 1.000
181     32 33 1.000
182     32 34 1.000
183     32 89 1.000
184     32 90 1.000
185     32 91 1.000
186     32 148 1.000
187     32 149 1.000
188     32 150 1.000
189     33 34 1.000
190     33 35 1.000
191     33 89 1.000
192     33 90 1.000
193     33 91 1.000
194     33 146 1.000
195     33 147 1.000
196     33 148 1.000
197     33 149 1.000
198     34 35 1.000
199     34 36 1.000
200     34 87 1.000
201     34 88 1.000
202     34 89 1.000
203     34 146 1.000
204     34 147 1.000
205     35 36 1.000
206     35 37 1.000
207     35 87 1.000
208     35 88 1.000
209     35 144 1.000
210     35 145 1.000
211     35 146 1.000
212     36 37 1.000
213     36 38 1.000
214     36 83 1.000
215     36 84 1.000
216     36 85 1.000
217     36 86 1.000
218     36 87 1.000
219     36 144 1.000
220     36 145 1.000
221     37 38 1.000
222     37 39 1.000
223     37 84 1.000
224     37 85 1.000
225     37 86 1.000
226     37 144 1.000
227     38 39 1.000
228     38 40 1.000
229     38 84 1.000
230     38 144 1.000
231     39 40 1.000
232     39 41 1.000
233     39 59 1.000
234     39 60 1.000
235     39 61 1.000
236     39 62 1.000
237     39 63 1.000
238     40 41 1.000
239     40 42 1.000
240     40 59 1.000
241     40 60 1.000
242     40 62 1.000
243     40 140 1.000
244     40 141 1.000
245     40 142 1.000
246     40 143 1.000
247     41 42 1.000
248     41 43 1.000
249     41 57 1.000
250     41 58 1.000
251     41 59 1.000
252     41 140 1.000
253     41 141 1.000
254     41 142 1.000
255     41 143 1.000
256     42 43 1.000
257     42 44 1.000
258     42 57 1.000
259     42 58 1.000
260     42 126 1.000
261     42 127 1.000
262     42 140 1.000
263     42 141 1.000
264     42 142 1.000
265     42 143 1.000
266     43 44 1.000
267     43 45 1.000
268     43 57 1.000
269     43 58 1.000
270     43 124 1.000
271     43 125 1.000
272     43 126 1.000
273     43 127 1.000
274     44 45 1.000
275     44 46 1.000
276     44 55 1.000
277     44 56 1.000
278     44 57 1.000
279     44 124 1.000
280     44 125 1.000
281     44 126 1.000
282     44 127 1.000
283     45 46 1.000
284     45 47 1.000
285     45 55 1.000
286     45 56 1.000
287     45 57 1.000
288     45 122 1.000
289     45 123 1.000
290     45 124 1.000
291     45 127 1.000
292     46 47 1.000
293     46 48 1.000
294     46 53 1.000
295     46 54 1.000
296     46 55 1.000
297     46 56 1.000
298     46 122 1.000
299     46 123 1.000
300     46 124 1.000
301     47 48 1.000
302     47 49 1.000
303     47 53 1.000
304     47 54 1.000
305     47 55 1.000
306     47 120 1.000
307     47 121 1.000
308     47 122 1.000
309     48 49 1.000
310     48 50 1.000
311     48 53 1.000
312     48 120 1.000
313     48 121 1.000
314     49 50 1.000
315     49 51 1.000
316     49 52 1.000
317     49 53 1.000
318     49 54 1.000
319     50 51 1.000
320     50 52 1.000
321     51 52 1.000
322     51 53 1.000
323     52 53 1.000
324     52 54 1.000
325     52 69 1.000
326     52 70 1.000
327     52 71 1.000
328     53 54 1.000
329     53 55 1.000
330     53 69 1.000
331     53 70 1.000
332     54 55 1.000
333     54 56 1.000
334     54 67 1.000
335     54 68 1.000
336     54 69 1.000
337     55 56 1.000
338     55 57 1.000
339     55 67 1.000
340     55 68 1.000
341     55 69 1.000
342     56 57 1.000
343     56 58 1.000
344     56 65 1.000
345     56 66 1.000
346     56 67 1.000
347     56 68 1.000
348     57 58 1.000
349     57 59 1.000
350     57 65 1.000
351     57 66 1.000
352     58 59 1.000
353     58 60 1.000
354     58 63 1.000
355     58 64 1.000
356     58 65 1.000
357     59 60 1.000
358     59 61 1.000
359     59 62 1.000
360     59 63 1.000
361     59 64 1.000
362     59 65 1.000
363     60 61 1.000
364     60 62 1.000
365     60 63 1.000
366     60 64 1.000
367     60 65 1.000
368     61 62 1.000
369     61 63 1.000
370     62 63 1.000
371     62 64 1.000
372     62 81 1.000
373     62 82 1.000
374     62 83 1.000
375     62 84 1.000
376     63 64 1.000
377     63 65 1.000
378     63 79 1.000
379     63 80 1.000
380     63 81 1.000
381     63 82 1.000
382     63 83 1.000
383     64 65 1.000
384     64 66 1.000
385     64 77 1.000
386     64 78 1.000
387     64 79 1.000
388     64 81 1.000
389     65 66 1.000
390     65 67 1.000
391     65 77 1.000
392     65 78 1.000
393     66 67 1.000
394     66 68 1.000
395     66 75 1.000
396     66 76 1.000
397     66 77 1.000
398     66 78 1.000
399     67 68 1.000
400     67 69 1.000
401     67 75 1.000
402     67 76 1.000
403     68 69 1.000
404     68 70 1.000
405     68 73 1.000
406     68 74 1.000
407     68 75 1.000
408     69 70 1.000
409     69 71 1.000
410     69 73 1.000
411     69 74 1.000
412     70 71 1.000
413     70 72 1.000
414     70 73 1.000
415     71 72 1.000
416     71 73 1.000
417     72 73 1.000
418     72 74 1.000
419     72 114 1.000
420     72 115 1.000
421     73 74 1.000
422     73 75 1.000
423     73 115 1.000
424     74 75 1.000
425     74 76 1.000
426     75 76 1.000
427     75 77 1.000
428     76 77 1.000
429     76 78 1.000
430     77 78 1.000
431     77 79 1.000
432     78 79 1.000
433     78 80 1.000
434     79 80 1.000
435     79 81 1.000
436     79 109 1.000
437     80 81 1.000
438     80 82 1.000
439     80 109 1.000
440     81 82 1.000
441     81 83 1.000
442     82 83 1.000
443     82 84 1.000
444     83 84 1.000
445     83 85 1.000
446     83 86 1.000
447     83 87 1.000
448     84 85 1.000
449     84 86 1.000
450     85 86 1.000
451     85 87 1.000
452     86 87 1.000
453     86 88 1.000
454     87 88 1.000
455     87 89 1.000
456     88 89 1.000
457     88 90 1.000
458     89 90 1.000
459     89 91 1.000
460     90 91 1.000
461     90 92 1.000
462     90 103 1.000
463     90 104 1.000
464     90 105 1.000
465     90 106 1.000
466     91 92 1.000
467     91 93 1.000
468     91 103 1.000
469     91 104 1.000
470     91 105 1.000
471     92 93 1.000
472     92 94 1.000
473     92 101 1.000
474     92 102 1.000
475     92 103 1.000
476     93 94 1.000
477     93 95 1.000
478     93 101 1.000
479     93 102 1.000
480     94 95 1.000
481     94 96 1.000
482     94 99 1.000
483     94 100 1.000
484     94 101 1.000
485     95 96 1.000
486     95 97 1.000
487     95 99 1.000
488     95 100 1.000
489     96 97 1.000
490     96 98 1.000
491     96 99 1.000
492     96 100 1.000
493     97 98 1.000
494     97 99 1.000
495     97 116 1.000
496     98 99 1.000
497     98 100 1.000
498     98 112 1.000
499     98 113 1.000
500     98 114 1.000
501     98 115 1.000
502     98 116 1.000
503     99 100 1.000
504     99 101 1.000
505     99 112 1.000
506     99 113 1.000
507     99 114 1.000
508     99 115 1.000
509     100 101 1.000
510     100 102 1.000
511     100 110 1.000
512     100 111 1.000
513     100 112 1.000
514     101 102 1.000
515     101 103 1.000
516     101 110 1.000
517     101 111 1.000
518     101 112 1.000
519     102 103 1.000
520     102 104 1.000
521     102 107 1.000
522     102 108 1.000
523     102 109 1.000
524     102 110 1.000
525     103 104 1.000
526     103 105 1.000
527     103 107 1.000
528     103 108 1.000
529     103 109 1.000
530     104 105 1.000
531     104 106 1.000
532     104 107 1.000
533     104 108 1.000
534     104 109 1.000
535     105 106 1.000
536     105 107 1.000
537     106 107 1.000
538     106 108 1.000
539     107 108 1.000
540     107 109 1.000
541     108 109 1.000
542     108 110 1.000
543     109 110 1.000
544     109 111 1.000
545     110 111 1.000
546     110 112 1.000
547     111 112 1.000
548     111 113 1.000
549     112 113 1.000
550     112 114 1.000
551     112 115 1.000
552     113 114 1.000
553     113 115 1.000
554     114 115 1.000
555     114 116 1.000
556     115 116 1.000
557     115 117 1.000
558     116 117 1.000
559     118 119 1.000
560     118 120 1.000
561     119 120 1.000
562     119 121 1.000
563     120 121 1.000
564     120 122 1.000
565     121 122 1.000
566     121 123 1.000
567     122 123 1.000
568     122 124 1.000
569     123 124 1.000
570     123 125 1.000
571     124 125 1.000
572     124 126 1.000
573     124 127 1.000
574     125 126 1.000
575     125 127 1.000
576     126 127 1.000
577     126 128 1.000
578     126 141 1.000
579     127 128 1.000
580     127 129 1.000
581     128 129 1.000
582     128 130 1.000
583     129 130 1.000
584     129 131 1.000
585     130 131 1.000
586     130 132 1.000
587     131 132 1.000
588     131 133 1.000
589     131 134 1.000
590     131 135 1.000
591     132 133 1.000
592     132 134 1.000
593     132 135 1.000
594     132 138 1.000
595     132 139 1.000
596     133 134 1.000
597     133 135 1.000
598     134 135 1.000
599     134 136 1.000
600     135 136 1.000
601     135 137 1.000
602     135 138 1.000
603     136 137 1.000
604     136 138 1.000
605     137 138 1.000
606     137 139 1.000
607     138 139 1.000
608     138 140 1.000
609     139 140 1.000
610     139 141 1.000
611     140 141 1.000
612     140 142 1.000
613     141 142 1.000
614     141 143 1.000
615     142 143 1.000
616     142 144 1.000
617     143 144 1.000
618     143 145 1.000
619     144 145 1.000
620     144 146 1.000
621     145 146 1.000
622     145 147 1.000
623     146 147 1.000
624     146 148 1.000
625     147 148 1.000
626     147 149 1.000
627     148 149 1.000
628     148 150 1.000
629     149 150 1.000
630     149 151 1.000
631     150 151 1.000
632     150 152 1.000
633     151 152 1.000
634     151 153 1.000
635     152 153 1.000
636     152 154 1.000
637     152 155 1.000
638     153 154 1.000
639     153 155 1.000
640     154 155 1.000
641     154 156 1.000
642     154 157 1.000
643     154 158 1.000
644     155 156 1.000
645     155 157 1.000
646     155 158 1.000
647     156 157 1.000
648     156 158 1.000
649     157 158 1.000
650     157 159 1.000
651     158 159 1.000
652     158 160 1.000
653     159 160 1.000
654     159 161 1.000
655     160 161 1.000
656     160 162 1.000
657     161 162 1.000
658     161 163 1.000
659     162 163 1.000
660     162 164 1.000
661     163 164 1.000
662     163 165 1.000
663     164 165 1.000
664     164 166 1.000
665     165 166 1.000
666     165 167 1.000
667     166 167 1.000
668     166 168 1.000
669     167 168 1.000
670     167 169 1.000
671     168 169 1.000
672     168 170 1.000
673     169 170 1.000