ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1d2sA_BB_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 9372 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
3 #PDB: 1d2s
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: BB
8 #CUTOFF: 5.0
9 1 2 1.000
10 1 3 1.000
11 2 3 1.000
12 2 4 1.000
13 2 147 1.000
14 2 148 1.000
15 2 149 1.000
16 3 4 1.000
17 3 5 1.000
18 3 147 1.000
19 3 148 1.000
20 3 168 1.000
21 3 169 1.000
22 3 170 1.000
23 4 5 1.000
24 4 6 1.000
25 4 145 1.000
26 4 146 1.000
27 4 147 1.000
28 4 168 1.000
29 4 169 1.000
30 4 170 1.000
31 5 6 1.000
32 5 7 1.000
33 5 145 1.000
34 5 146 1.000
35 5 168 1.000
36 5 169 1.000
37 5 170 1.000
38 6 7 1.000
39 6 8 1.000
40 6 125 1.000
41 6 126 1.000
42 6 143 1.000
43 6 145 1.000
44 6 146 1.000
45 7 8 1.000
46 7 9 1.000
47 7 11 1.000
48 7 143 1.000
49 7 145 1.000
50 8 9 1.000
51 8 10 1.000
52 8 11 1.000
53 9 10 1.000
54 9 11 1.000
55 10 11 1.000
56 10 12 1.000
57 11 12 1.000
58 11 13 1.000
59 11 141 1.000
60 11 142 1.000
61 12 13 1.000
62 12 14 1.000
63 13 14 1.000
64 13 15 1.000
65 13 126 1.000
66 13 127 1.000
67 14 15 1.000
68 14 16 1.000
69 14 125 1.000
70 14 126 1.000
71 14 127 1.000
72 14 128 1.000
73 14 164 1.000
74 15 16 1.000
75 15 17 1.000
76 15 125 1.000
77 15 126 1.000
78 15 162 1.000
79 15 163 1.000
80 15 164 1.000
81 15 165 1.000
82 16 17 1.000
83 16 18 1.000
84 16 123 1.000
85 16 124 1.000
86 16 125 1.000
87 16 162 1.000
88 16 163 1.000
89 17 18 1.000
90 17 19 1.000
91 17 123 1.000
92 17 124 1.000
93 17 160 1.000
94 17 161 1.000
95 17 162 1.000
96 17 163 1.000
97 18 19 1.000
98 18 20 1.000
99 18 121 1.000
100 18 122 1.000
101 18 123 1.000
102 18 160 1.000
103 18 161 1.000
104 19 20 1.000
105 19 21 1.000
106 19 121 1.000
107 19 122 1.000
108 19 157 1.000
109 19 158 1.000
110 19 159 1.000
111 19 160 1.000
112 19 161 1.000
113 20 21 1.000
114 20 22 1.000
115 20 119 1.000
116 20 120 1.000
117 20 121 1.000
118 20 122 1.000
119 20 157 1.000
120 20 158 1.000
121 20 159 1.000
122 21 22 1.000
123 21 23 1.000
124 21 24 1.000
125 21 25 1.000
126 21 119 1.000
127 21 120 1.000
128 21 157 1.000
129 21 158 1.000
130 21 159 1.000
131 22 23 1.000
132 22 24 1.000
133 22 25 1.000
134 22 118 1.000
135 22 119 1.000
136 22 120 1.000
137 22 121 1.000
138 23 24 1.000
139 23 25 1.000
140 23 119 1.000
141 24 25 1.000
142 24 26 1.000
143 24 157 1.000
144 25 26 1.000
145 25 27 1.000
146 26 27 1.000
147 26 28 1.000
148 27 28 1.000
149 27 29 1.000
150 27 153 1.000
151 27 154 1.000
152 28 29 1.000
153 28 30 1.000
154 28 93 1.000
155 28 94 1.000
156 28 95 1.000
157 29 30 1.000
158 29 31 1.000
159 29 93 1.000
160 29 94 1.000
161 29 95 1.000
162 29 151 1.000
163 29 152 1.000
164 29 153 1.000
165 30 31 1.000
166 30 32 1.000
167 30 91 1.000
168 30 92 1.000
169 30 93 1.000
170 30 151 1.000
171 30 152 1.000
172 30 153 1.000
173 31 32 1.000
174 31 33 1.000
175 31 91 1.000
176 31 92 1.000
177 31 93 1.000
178 31 149 1.000
179 31 150 1.000
180 31 151 1.000
181 32 33 1.000
182 32 34 1.000
183 32 89 1.000
184 32 90 1.000
185 32 91 1.000
186 32 148 1.000
187 32 149 1.000
188 32 150 1.000
189 33 34 1.000
190 33 35 1.000
191 33 89 1.000
192 33 90 1.000
193 33 91 1.000
194 33 146 1.000
195 33 147 1.000
196 33 148 1.000
197 33 149 1.000
198 34 35 1.000
199 34 36 1.000
200 34 87 1.000
201 34 88 1.000
202 34 89 1.000
203 34 146 1.000
204 34 147 1.000
205 35 36 1.000
206 35 37 1.000
207 35 87 1.000
208 35 88 1.000
209 35 144 1.000
210 35 145 1.000
211 35 146 1.000
212 36 37 1.000
213 36 38 1.000
214 36 83 1.000
215 36 84 1.000
216 36 85 1.000
217 36 86 1.000
218 36 87 1.000
219 36 144 1.000
220 36 145 1.000
221 37 38 1.000
222 37 39 1.000
223 37 84 1.000
224 37 85 1.000
225 37 86 1.000
226 37 144 1.000
227 38 39 1.000
228 38 40 1.000
229 38 84 1.000
230 38 144 1.000
231 39 40 1.000
232 39 41 1.000
233 39 59 1.000
234 39 60 1.000
235 39 61 1.000
236 39 62 1.000
237 39 63 1.000
238 40 41 1.000
239 40 42 1.000
240 40 59 1.000
241 40 60 1.000
242 40 62 1.000
243 40 140 1.000
244 40 141 1.000
245 40 142 1.000
246 40 143 1.000
247 41 42 1.000
248 41 43 1.000
249 41 57 1.000
250 41 58 1.000
251 41 59 1.000
252 41 140 1.000
253 41 141 1.000
254 41 142 1.000
255 41 143 1.000
256 42 43 1.000
257 42 44 1.000
258 42 57 1.000
259 42 58 1.000
260 42 126 1.000
261 42 127 1.000
262 42 140 1.000
263 42 141 1.000
264 42 142 1.000
265 42 143 1.000
266 43 44 1.000
267 43 45 1.000
268 43 57 1.000
269 43 58 1.000
270 43 124 1.000
271 43 125 1.000
272 43 126 1.000
273 43 127 1.000
274 44 45 1.000
275 44 46 1.000
276 44 55 1.000
277 44 56 1.000
278 44 57 1.000
279 44 124 1.000
280 44 125 1.000
281 44 126 1.000
282 44 127 1.000
283 45 46 1.000
284 45 47 1.000
285 45 55 1.000
286 45 56 1.000
287 45 57 1.000
288 45 122 1.000
289 45 123 1.000
290 45 124 1.000
291 45 127 1.000
292 46 47 1.000
293 46 48 1.000
294 46 53 1.000
295 46 54 1.000
296 46 55 1.000
297 46 56 1.000
298 46 122 1.000
299 46 123 1.000
300 46 124 1.000
301 47 48 1.000
302 47 49 1.000
303 47 53 1.000
304 47 54 1.000
305 47 55 1.000
306 47 120 1.000
307 47 121 1.000
308 47 122 1.000
309 48 49 1.000
310 48 50 1.000
311 48 53 1.000
312 48 120 1.000
313 48 121 1.000
314 49 50 1.000
315 49 51 1.000
316 49 52 1.000
317 49 53 1.000
318 49 54 1.000
319 50 51 1.000
320 50 52 1.000
321 51 52 1.000
322 51 53 1.000
323 52 53 1.000
324 52 54 1.000
325 52 69 1.000
326 52 70 1.000
327 52 71 1.000
328 53 54 1.000
329 53 55 1.000
330 53 69 1.000
331 53 70 1.000
332 54 55 1.000
333 54 56 1.000
334 54 67 1.000
335 54 68 1.000
336 54 69 1.000
337 55 56 1.000
338 55 57 1.000
339 55 67 1.000
340 55 68 1.000
341 55 69 1.000
342 56 57 1.000
343 56 58 1.000
344 56 65 1.000
345 56 66 1.000
346 56 67 1.000
347 56 68 1.000
348 57 58 1.000
349 57 59 1.000
350 57 65 1.000
351 57 66 1.000
352 58 59 1.000
353 58 60 1.000
354 58 63 1.000
355 58 64 1.000
356 58 65 1.000
357 59 60 1.000
358 59 61 1.000
359 59 62 1.000
360 59 63 1.000
361 59 64 1.000
362 59 65 1.000
363 60 61 1.000
364 60 62 1.000
365 60 63 1.000
366 60 64 1.000
367 60 65 1.000
368 61 62 1.000
369 61 63 1.000
370 62 63 1.000
371 62 64 1.000
372 62 81 1.000
373 62 82 1.000
374 62 83 1.000
375 62 84 1.000
376 63 64 1.000
377 63 65 1.000
378 63 79 1.000
379 63 80 1.000
380 63 81 1.000
381 63 82 1.000
382 63 83 1.000
383 64 65 1.000
384 64 66 1.000
385 64 77 1.000
386 64 78 1.000
387 64 79 1.000
388 64 81 1.000
389 65 66 1.000
390 65 67 1.000
391 65 77 1.000
392 65 78 1.000
393 66 67 1.000
394 66 68 1.000
395 66 75 1.000
396 66 76 1.000
397 66 77 1.000
398 66 78 1.000
399 67 68 1.000
400 67 69 1.000
401 67 75 1.000
402 67 76 1.000
403 68 69 1.000
404 68 70 1.000
405 68 73 1.000
406 68 74 1.000
407 68 75 1.000
408 69 70 1.000
409 69 71 1.000
410 69 73 1.000
411 69 74 1.000
412 70 71 1.000
413 70 72 1.000
414 70 73 1.000
415 71 72 1.000
416 71 73 1.000
417 72 73 1.000
418 72 74 1.000
419 72 114 1.000
420 72 115 1.000
421 73 74 1.000
422 73 75 1.000
423 73 115 1.000
424 74 75 1.000
425 74 76 1.000
426 75 76 1.000
427 75 77 1.000
428 76 77 1.000
429 76 78 1.000
430 77 78 1.000
431 77 79 1.000
432 78 79 1.000
433 78 80 1.000
434 79 80 1.000
435 79 81 1.000
436 79 109 1.000
437 80 81 1.000
438 80 82 1.000
439 80 109 1.000
440 81 82 1.000
441 81 83 1.000
442 82 83 1.000
443 82 84 1.000
444 83 84 1.000
445 83 85 1.000
446 83 86 1.000
447 83 87 1.000
448 84 85 1.000
449 84 86 1.000
450 85 86 1.000
451 85 87 1.000
452 86 87 1.000
453 86 88 1.000
454 87 88 1.000
455 87 89 1.000
456 88 89 1.000
457 88 90 1.000
458 89 90 1.000
459 89 91 1.000
460 90 91 1.000
461 90 92 1.000
462 90 103 1.000
463 90 104 1.000
464 90 105 1.000
465 90 106 1.000
466 91 92 1.000
467 91 93 1.000
468 91 103 1.000
469 91 104 1.000
470 91 105 1.000
471 92 93 1.000
472 92 94 1.000
473 92 101 1.000
474 92 102 1.000
475 92 103 1.000
476 93 94 1.000
477 93 95 1.000
478 93 101 1.000
479 93 102 1.000
480 94 95 1.000
481 94 96 1.000
482 94 99 1.000
483 94 100 1.000
484 94 101 1.000
485 95 96 1.000
486 95 97 1.000
487 95 99 1.000
488 95 100 1.000
489 96 97 1.000
490 96 98 1.000
491 96 99 1.000
492 96 100 1.000
493 97 98 1.000
494 97 99 1.000
495 97 116 1.000
496 98 99 1.000
497 98 100 1.000
498 98 112 1.000
499 98 113 1.000
500 98 114 1.000
501 98 115 1.000
502 98 116 1.000
503 99 100 1.000
504 99 101 1.000
505 99 112 1.000
506 99 113 1.000
507 99 114 1.000
508 99 115 1.000
509 100 101 1.000
510 100 102 1.000
511 100 110 1.000
512 100 111 1.000
513 100 112 1.000
514 101 102 1.000
515 101 103 1.000
516 101 110 1.000
517 101 111 1.000
518 101 112 1.000
519 102 103 1.000
520 102 104 1.000
521 102 107 1.000
522 102 108 1.000
523 102 109 1.000
524 102 110 1.000
525 103 104 1.000
526 103 105 1.000
527 103 107 1.000
528 103 108 1.000
529 103 109 1.000
530 104 105 1.000
531 104 106 1.000
532 104 107 1.000
533 104 108 1.000
534 104 109 1.000
535 105 106 1.000
536 105 107 1.000
537 106 107 1.000
538 106 108 1.000
539 107 108 1.000
540 107 109 1.000
541 108 109 1.000
542 108 110 1.000
543 109 110 1.000
544 109 111 1.000
545 110 111 1.000
546 110 112 1.000
547 111 112 1.000
548 111 113 1.000
549 112 113 1.000
550 112 114 1.000
551 112 115 1.000
552 113 114 1.000
553 113 115 1.000
554 114 115 1.000
555 114 116 1.000
556 115 116 1.000
557 115 117 1.000
558 116 117 1.000
559 118 119 1.000
560 118 120 1.000
561 119 120 1.000
562 119 121 1.000
563 120 121 1.000
564 120 122 1.000
565 121 122 1.000
566 121 123 1.000
567 122 123 1.000
568 122 124 1.000
569 123 124 1.000
570 123 125 1.000
571 124 125 1.000
572 124 126 1.000
573 124 127 1.000
574 125 126 1.000
575 125 127 1.000
576 126 127 1.000
577 126 128 1.000
578 126 141 1.000
579 127 128 1.000
580 127 129 1.000
581 128 129 1.000
582 128 130 1.000
583 129 130 1.000
584 129 131 1.000
585 130 131 1.000
586 130 132 1.000
587 131 132 1.000
588 131 133 1.000
589 131 134 1.000
590 131 135 1.000
591 132 133 1.000
592 132 134 1.000
593 132 135 1.000
594 132 138 1.000
595 132 139 1.000
596 133 134 1.000
597 133 135 1.000
598 134 135 1.000
599 134 136 1.000
600 135 136 1.000
601 135 137 1.000
602 135 138 1.000
603 136 137 1.000
604 136 138 1.000
605 137 138 1.000
606 137 139 1.000
607 138 139 1.000
608 138 140 1.000
609 139 140 1.000
610 139 141 1.000
611 140 141 1.000
612 140 142 1.000
613 141 142 1.000
614 141 143 1.000
615 142 143 1.000
616 142 144 1.000
617 143 144 1.000
618 143 145 1.000
619 144 145 1.000
620 144 146 1.000
621 145 146 1.000
622 145 147 1.000
623 146 147 1.000
624 146 148 1.000
625 147 148 1.000
626 147 149 1.000
627 148 149 1.000
628 148 150 1.000
629 149 150 1.000
630 149 151 1.000
631 150 151 1.000
632 150 152 1.000
633 151 152 1.000
634 151 153 1.000
635 152 153 1.000
636 152 154 1.000
637 152 155 1.000
638 153 154 1.000
639 153 155 1.000
640 154 155 1.000
641 154 156 1.000
642 154 157 1.000
643 154 158 1.000
644 155 156 1.000
645 155 157 1.000
646 155 158 1.000
647 156 157 1.000
648 156 158 1.000
649 157 158 1.000
650 157 159 1.000
651 158 159 1.000
652 158 160 1.000
653 159 160 1.000
654 159 161 1.000
655 160 161 1.000
656 160 162 1.000
657 161 162 1.000
658 161 163 1.000
659 162 163 1.000
660 162 164 1.000
661 163 164 1.000
662 163 165 1.000
663 164 165 1.000
664 164 166 1.000
665 165 166 1.000
666 165 167 1.000
667 166 167 1.000
668 166 168 1.000
669 167 168 1.000
670 167 169 1.000
671 168 169 1.000
672 168 170 1.000
673 169 170 1.000