ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1d2sA_Ca_8.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 9 months ago) by duarte
File size: 12163 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line User Rev File contents
1 duarte 884 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
3     #PDB: 1d2s
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: Ca
8     #CUTOFF: 8.0
9     1 2 1.000
10     1 3 1.000
11     1 148 1.000
12     1 149 1.000
13     2 3 1.000
14     2 4 1.000
15     2 148 1.000
16     2 149 1.000
17     2 169 1.000
18     2 170 1.000
19     3 4 1.000
20     3 5 1.000
21     3 146 1.000
22     3 147 1.000
23     3 148 1.000
24     3 149 1.000
25     3 169 1.000
26     3 170 1.000
27     4 5 1.000
28     4 6 1.000
29     4 146 1.000
30     4 147 1.000
31     4 148 1.000
32     4 167 1.000
33     4 168 1.000
34     4 169 1.000
35     4 170 1.000
36     5 6 1.000
37     5 7 1.000
38     5 8 1.000
39     5 144 1.000
40     5 145 1.000
41     5 146 1.000
42     5 147 1.000
43     5 167 1.000
44     5 168 1.000
45     5 169 1.000
46     5 170 1.000
47     6 7 1.000
48     6 8 1.000
49     6 14 1.000
50     6 15 1.000
51     6 43 1.000
52     6 125 1.000
53     6 126 1.000
54     6 143 1.000
55     6 144 1.000
56     6 145 1.000
57     6 146 1.000
58     6 147 1.000
59     7 8 1.000
60     7 9 1.000
61     7 10 1.000
62     7 11 1.000
63     7 14 1.000
64     7 15 1.000
65     7 126 1.000
66     7 142 1.000
67     7 143 1.000
68     7 144 1.000
69     7 145 1.000
70     8 9 1.000
71     8 10 1.000
72     8 11 1.000
73     8 15 1.000
74     8 165 1.000
75     8 168 1.000
76     9 10 1.000
77     9 11 1.000
78     10 11 1.000
79     10 12 1.000
80     10 142 1.000
81     11 12 1.000
82     11 13 1.000
83     11 14 1.000
84     11 126 1.000
85     11 127 1.000
86     11 141 1.000
87     11 142 1.000
88     11 143 1.000
89     12 13 1.000
90     12 14 1.000
91     12 127 1.000
92     12 141 1.000
93     12 142 1.000
94     13 14 1.000
95     13 15 1.000
96     13 126 1.000
97     13 127 1.000
98     13 128 1.000
99     13 129 1.000
100     14 15 1.000
101     14 16 1.000
102     14 17 1.000
103     14 124 1.000
104     14 125 1.000
105     14 126 1.000
106     14 127 1.000
107     14 128 1.000
108     14 129 1.000
109     14 163 1.000
110     14 164 1.000
111     15 16 1.000
112     15 17 1.000
113     15 124 1.000
114     15 125 1.000
115     15 126 1.000
116     15 127 1.000
117     15 163 1.000
118     15 164 1.000
119     15 165 1.000
120     15 166 1.000
121     15 167 1.000
122     16 17 1.000
123     16 18 1.000
124     16 124 1.000
125     16 125 1.000
126     16 126 1.000
127     16 161 1.000
128     16 162 1.000
129     16 163 1.000
130     16 164 1.000
131     16 167 1.000
132     17 18 1.000
133     17 19 1.000
134     17 122 1.000
135     17 123 1.000
136     17 124 1.000
137     17 125 1.000
138     17 161 1.000
139     17 162 1.000
140     17 163 1.000
141     18 19 1.000
142     18 20 1.000
143     18 122 1.000
144     18 123 1.000
145     18 124 1.000
146     18 158 1.000
147     18 159 1.000
148     18 160 1.000
149     18 161 1.000
150     18 162 1.000
151     19 20 1.000
152     19 21 1.000
153     19 120 1.000
154     19 121 1.000
155     19 122 1.000
156     19 123 1.000
157     19 158 1.000
158     19 159 1.000
159     19 160 1.000
160     19 161 1.000
161     20 21 1.000
162     20 22 1.000
163     20 25 1.000
164     20 120 1.000
165     20 121 1.000
166     20 122 1.000
167     20 154 1.000
168     20 157 1.000
169     20 158 1.000
170     20 159 1.000
171     20 160 1.000
172     21 22 1.000
173     21 23 1.000
174     21 24 1.000
175     21 25 1.000
176     21 119 1.000
177     21 120 1.000
178     21 121 1.000
179     21 157 1.000
180     21 158 1.000
181     21 159 1.000
182     22 23 1.000
183     22 24 1.000
184     22 25 1.000
185     22 118 1.000
186     22 119 1.000
187     22 120 1.000
188     22 121 1.000
189     22 157 1.000
190     23 24 1.000
191     23 25 1.000
192     23 119 1.000
193     24 25 1.000
194     24 26 1.000
195     24 156 1.000
196     24 157 1.000
197     25 26 1.000
198     25 27 1.000
199     25 28 1.000
200     25 153 1.000
201     25 154 1.000
202     25 156 1.000
203     25 157 1.000
204     26 27 1.000
205     26 28 1.000
206     26 154 1.000
207     27 28 1.000
208     27 29 1.000
209     27 153 1.000
210     27 154 1.000
211     28 29 1.000
212     28 30 1.000
213     28 94 1.000
214     28 95 1.000
215     28 153 1.000
216     28 154 1.000
217     29 30 1.000
218     29 31 1.000
219     29 92 1.000
220     29 93 1.000
221     29 94 1.000
222     29 95 1.000
223     29 152 1.000
224     29 153 1.000
225     29 154 1.000
226     30 31 1.000
227     30 32 1.000
228     30 92 1.000
229     30 93 1.000
230     30 94 1.000
231     30 150 1.000
232     30 151 1.000
233     30 152 1.000
234     30 153 1.000
235     31 32 1.000
236     31 33 1.000
237     31 90 1.000
238     31 91 1.000
239     31 92 1.000
240     31 93 1.000
241     31 149 1.000
242     31 150 1.000
243     31 151 1.000
244     31 152 1.000
245     32 33 1.000
246     32 34 1.000
247     32 90 1.000
248     32 91 1.000
249     32 92 1.000
250     32 147 1.000
251     32 148 1.000
252     32 149 1.000
253     32 150 1.000
254     32 151 1.000
255     33 34 1.000
256     33 35 1.000
257     33 88 1.000
258     33 89 1.000
259     33 90 1.000
260     33 91 1.000
261     33 147 1.000
262     33 148 1.000
263     33 149 1.000
264     33 150 1.000
265     34 35 1.000
266     34 36 1.000
267     34 88 1.000
268     34 89 1.000
269     34 90 1.000
270     34 91 1.000
271     34 145 1.000
272     34 146 1.000
273     34 147 1.000
274     34 148 1.000
275     35 36 1.000
276     35 37 1.000
277     35 83 1.000
278     35 84 1.000
279     35 85 1.000
280     35 86 1.000
281     35 87 1.000
282     35 88 1.000
283     35 89 1.000
284     35 145 1.000
285     35 146 1.000
286     35 147 1.000
287     36 37 1.000
288     36 38 1.000
289     36 83 1.000
290     36 84 1.000
291     36 85 1.000
292     36 86 1.000
293     36 87 1.000
294     36 88 1.000
295     36 144 1.000
296     36 145 1.000
297     36 146 1.000
298     37 38 1.000
299     37 39 1.000
300     37 83 1.000
301     37 84 1.000
302     37 85 1.000
303     37 86 1.000
304     37 144 1.000
305     37 145 1.000
306     38 39 1.000
307     38 40 1.000
308     38 41 1.000
309     38 62 1.000
310     38 84 1.000
311     38 143 1.000
312     38 144 1.000
313     38 145 1.000
314     39 40 1.000
315     39 41 1.000
316     39 59 1.000
317     39 60 1.000
318     39 61 1.000
319     39 62 1.000
320     39 63 1.000
321     39 83 1.000
322     39 84 1.000
323     40 41 1.000
324     40 42 1.000
325     40 58 1.000
326     40 59 1.000
327     40 60 1.000
328     40 61 1.000
329     40 62 1.000
330     40 139 1.000
331     40 140 1.000
332     40 141 1.000
333     40 142 1.000
334     40 143 1.000
335     41 42 1.000
336     41 43 1.000
337     41 58 1.000
338     41 59 1.000
339     41 60 1.000
340     41 126 1.000
341     41 139 1.000
342     41 140 1.000
343     41 141 1.000
344     41 142 1.000
345     41 143 1.000
346     41 144 1.000
347     42 43 1.000
348     42 44 1.000
349     42 45 1.000
350     42 56 1.000
351     42 57 1.000
352     42 58 1.000
353     42 59 1.000
354     42 125 1.000
355     42 126 1.000
356     42 127 1.000
357     42 128 1.000
358     42 140 1.000
359     42 141 1.000
360     42 142 1.000
361     42 143 1.000
362     43 44 1.000
363     43 45 1.000
364     43 56 1.000
365     43 57 1.000
366     43 58 1.000
367     43 59 1.000
368     43 125 1.000
369     43 126 1.000
370     43 127 1.000
371     43 143 1.000
372     44 45 1.000
373     44 46 1.000
374     44 56 1.000
375     44 57 1.000
376     44 58 1.000
377     44 123 1.000
378     44 124 1.000
379     44 125 1.000
380     44 126 1.000
381     44 127 1.000
382     44 128 1.000
383     45 46 1.000
384     45 47 1.000
385     45 54 1.000
386     45 55 1.000
387     45 56 1.000
388     45 57 1.000
389     45 123 1.000
390     45 124 1.000
391     45 125 1.000
392     45 126 1.000
393     45 127 1.000
394     45 128 1.000
395     45 129 1.000
396     46 47 1.000
397     46 48 1.000
398     46 54 1.000
399     46 55 1.000
400     46 56 1.000
401     46 121 1.000
402     46 122 1.000
403     46 123 1.000
404     46 124 1.000
405     47 48 1.000
406     47 49 1.000
407     47 50 1.000
408     47 53 1.000
409     47 54 1.000
410     47 55 1.000
411     47 121 1.000
412     47 122 1.000
413     47 123 1.000
414     48 49 1.000
415     48 50 1.000
416     48 52 1.000
417     48 53 1.000
418     48 54 1.000
419     48 118 1.000
420     48 119 1.000
421     48 120 1.000
422     48 121 1.000
423     48 122 1.000
424     49 50 1.000
425     49 51 1.000
426     49 52 1.000
427     49 53 1.000
428     49 54 1.000
429     49 118 1.000
430     50 51 1.000
431     50 52 1.000
432     50 53 1.000
433     50 54 1.000
434     50 129 1.000
435     50 130 1.000
436     51 52 1.000
437     51 53 1.000
438     51 54 1.000
439     52 53 1.000
440     52 54 1.000
441     52 69 1.000
442     52 70 1.000
443     52 71 1.000
444     53 54 1.000
445     53 55 1.000
446     53 68 1.000
447     53 69 1.000
448     53 70 1.000
449     53 71 1.000
450     54 55 1.000
451     54 56 1.000
452     54 68 1.000
453     54 69 1.000
454     54 70 1.000
455     55 56 1.000
456     55 57 1.000
457     55 66 1.000
458     55 67 1.000
459     55 68 1.000
460     55 69 1.000
461     56 57 1.000
462     56 58 1.000
463     56 65 1.000
464     56 66 1.000
465     56 67 1.000
466     56 68 1.000
467     56 128 1.000
468     57 58 1.000
469     57 59 1.000
470     57 64 1.000
471     57 65 1.000
472     57 66 1.000
473     57 67 1.000
474     58 59 1.000
475     58 60 1.000
476     58 64 1.000
477     58 65 1.000
478     58 66 1.000
479     59 60 1.000
480     59 61 1.000
481     59 62 1.000
482     59 63 1.000
483     59 64 1.000
484     59 65 1.000
485     59 83 1.000
486     60 61 1.000
487     60 62 1.000
488     60 63 1.000
489     60 64 1.000
490     60 65 1.000
491     60 78 1.000
492     60 139 1.000
493     61 62 1.000
494     61 63 1.000
495     61 82 1.000
496     62 63 1.000
497     62 64 1.000
498     62 81 1.000
499     62 82 1.000
500     62 83 1.000
501     62 84 1.000
502     63 64 1.000
503     63 65 1.000
504     63 78 1.000
505     63 79 1.000
506     63 80 1.000
507     63 81 1.000
508     63 82 1.000
509     63 83 1.000
510     63 84 1.000
511     64 65 1.000
512     64 66 1.000
513     64 78 1.000
514     64 79 1.000
515     64 80 1.000
516     64 81 1.000
517     64 82 1.000
518     64 83 1.000
519     65 66 1.000
520     65 67 1.000
521     65 76 1.000
522     65 77 1.000
523     65 78 1.000
524     65 79 1.000
525     66 67 1.000
526     66 68 1.000
527     66 75 1.000
528     66 76 1.000
529     66 77 1.000
530     66 78 1.000
531     67 68 1.000
532     67 69 1.000
533     67 74 1.000
534     67 75 1.000
535     67 76 1.000
536     67 77 1.000
537     67 135 1.000
538     67 136 1.000
539     67 137 1.000
540     68 69 1.000
541     68 70 1.000
542     68 73 1.000
543     68 74 1.000
544     68 75 1.000
545     68 76 1.000
546     69 70 1.000
547     69 71 1.000
548     69 72 1.000
549     69 73 1.000
550     69 74 1.000
551     69 75 1.000
552     70 71 1.000
553     70 72 1.000
554     70 73 1.000
555     70 74 1.000
556     70 115 1.000
557     70 116 1.000
558     71 72 1.000
559     71 73 1.000
560     72 73 1.000
561     72 74 1.000
562     72 114 1.000
563     72 115 1.000
564     72 116 1.000
565     72 117 1.000
566     73 74 1.000
567     73 75 1.000
568     73 114 1.000
569     73 115 1.000
570     73 116 1.000
571     74 75 1.000
572     74 76 1.000
573     75 76 1.000
574     75 77 1.000
575     75 136 1.000
576     76 77 1.000
577     76 78 1.000
578     76 136 1.000
579     76 137 1.000
580     77 78 1.000
581     77 79 1.000
582     78 79 1.000
583     78 80 1.000
584     79 80 1.000
585     79 81 1.000
586     79 109 1.000
587     79 110 1.000
588     80 81 1.000
589     80 82 1.000
590     80 104 1.000
591     80 109 1.000
592     80 110 1.000
593     81 82 1.000
594     81 83 1.000
595     82 83 1.000
596     82 84 1.000
597     82 85 1.000
598     83 84 1.000
599     83 85 1.000
600     83 86 1.000
601     83 87 1.000
602     83 89 1.000
603     84 85 1.000
604     84 86 1.000
605     84 87 1.000
606     85 86 1.000
607     85 87 1.000
608     86 87 1.000
609     86 88 1.000
610     87 88 1.000
611     87 89 1.000
612     88 89 1.000
613     88 90 1.000
614     89 90 1.000
615     89 91 1.000
616     89 104 1.000
617     89 105 1.000
618     90 91 1.000
619     90 92 1.000
620     90 103 1.000
621     90 104 1.000
622     90 105 1.000
623     90 106 1.000
624     91 92 1.000
625     91 93 1.000
626     91 102 1.000
627     91 103 1.000
628     91 104 1.000
629     91 105 1.000
630     91 106 1.000
631     92 93 1.000
632     92 94 1.000
633     92 101 1.000
634     92 102 1.000
635     92 103 1.000
636     92 104 1.000
637     93 94 1.000
638     93 95 1.000
639     93 100 1.000
640     93 101 1.000
641     93 102 1.000
642     93 103 1.000
643     94 95 1.000
644     94 96 1.000
645     94 100 1.000
646     94 101 1.000
647     94 102 1.000
648     95 96 1.000
649     95 97 1.000
650     95 98 1.000
651     95 99 1.000
652     95 100 1.000
653     95 101 1.000
654     96 97 1.000
655     96 98 1.000
656     96 99 1.000
657     96 100 1.000
658     96 101 1.000
659     97 98 1.000
660     97 99 1.000
661     97 116 1.000
662     98 99 1.000
663     98 100 1.000
664     98 113 1.000
665     98 114 1.000
666     98 115 1.000
667     98 116 1.000
668     98 117 1.000
669     99 100 1.000
670     99 101 1.000
671     99 111 1.000
672     99 112 1.000
673     99 113 1.000
674     99 114 1.000
675     99 115 1.000
676     99 116 1.000
677     100 101 1.000
678     100 102 1.000
679     100 111 1.000
680     100 112 1.000
681     100 113 1.000
682     100 115 1.000
683     100 116 1.000
684     101 102 1.000
685     101 103 1.000
686     101 108 1.000
687     101 109 1.000
688     101 110 1.000
689     101 111 1.000
690     101 112 1.000
691     102 103 1.000
692     102 104 1.000
693     102 108 1.000
694     102 109 1.000
695     102 110 1.000
696     102 111 1.000
697     103 104 1.000
698     103 105 1.000
699     103 106 1.000
700     103 107 1.000
701     103 108 1.000
702     103 109 1.000
703     103 110 1.000
704     104 105 1.000
705     104 106 1.000
706     104 107 1.000
707     104 108 1.000
708     104 109 1.000
709     105 106 1.000
710     105 107 1.000
711     106 107 1.000
712     106 108 1.000
713     107 108 1.000
714     107 109 1.000
715     108 109 1.000
716     108 110 1.000
717     108 111 1.000
718     109 110 1.000
719     109 111 1.000
720     110 111 1.000
721     110 112 1.000
722     111 112 1.000
723     111 113 1.000
724     112 113 1.000
725     112 114 1.000
726     112 115 1.000
727     113 114 1.000
728     113 115 1.000
729     114 115 1.000
730     114 116 1.000
731     114 117 1.000
732     115 116 1.000
733     115 117 1.000
734     116 117 1.000
735     118 119 1.000
736     118 120 1.000
737     118 121 1.000
738     119 120 1.000
739     119 121 1.000
740     120 121 1.000
741     120 122 1.000
742     121 122 1.000
743     121 123 1.000
744     122 123 1.000
745     122 124 1.000
746     123 124 1.000
747     123 125 1.000
748     123 152 1.000
749     124 125 1.000
750     124 126 1.000
751     124 127 1.000
752     124 128 1.000
753     124 129 1.000
754     125 126 1.000
755     125 127 1.000
756     125 128 1.000
757     126 127 1.000
758     126 128 1.000
759     126 141 1.000
760     126 142 1.000
761     126 143 1.000
762     127 128 1.000
763     127 129 1.000
764     127 141 1.000
765     127 142 1.000
766     128 129 1.000
767     128 130 1.000
768     128 131 1.000
769     128 132 1.000
770     128 141 1.000
771     129 130 1.000
772     129 131 1.000
773     130 131 1.000
774     130 132 1.000
775     130 134 1.000
776     131 132 1.000
777     131 133 1.000
778     131 134 1.000
779     131 135 1.000
780     132 133 1.000
781     132 134 1.000
782     132 135 1.000
783     132 138 1.000
784     132 139 1.000
785     132 140 1.000
786     132 141 1.000
787     133 134 1.000
788     133 135 1.000
789     133 137 1.000
790     133 138 1.000
791     133 139 1.000
792     134 135 1.000
793     134 136 1.000
794     134 138 1.000
795     135 136 1.000
796     135 137 1.000
797     135 138 1.000
798     135 139 1.000
799     136 137 1.000
800     136 138 1.000
801     137 138 1.000
802     137 139 1.000
803     138 139 1.000
804     138 140 1.000
805     139 140 1.000
806     139 141 1.000
807     140 141 1.000
808     140 142 1.000
809     141 142 1.000
810     141 143 1.000
811     142 143 1.000
812     142 144 1.000
813     143 144 1.000
814     143 145 1.000
815     144 145 1.000
816     144 146 1.000
817     145 146 1.000
818     145 147 1.000
819     146 147 1.000
820     146 148 1.000
821     146 170 1.000
822     147 148 1.000
823     147 149 1.000
824     147 150 1.000
825     148 149 1.000
826     148 150 1.000
827     149 150 1.000
828     149 151 1.000
829     150 151 1.000
830     150 152 1.000
831     151 152 1.000
832     151 153 1.000
833     151 154 1.000
834     151 155 1.000
835     152 153 1.000
836     152 154 1.000
837     152 155 1.000
838     153 154 1.000
839     153 155 1.000
840     154 155 1.000
841     154 156 1.000
842     154 157 1.000
843     154 158 1.000
844     155 156 1.000
845     155 157 1.000
846     155 158 1.000
847     156 157 1.000
848     156 158 1.000
849     157 158 1.000
850     157 159 1.000
851     158 159 1.000
852     158 160 1.000
853     158 161 1.000
854     159 160 1.000
855     159 161 1.000
856     160 161 1.000
857     160 162 1.000
858     161 162 1.000
859     161 163 1.000
860     162 163 1.000
861     162 164 1.000
862     163 164 1.000
863     163 165 1.000
864     163 166 1.000
865     163 167 1.000
866     164 165 1.000
867     164 166 1.000
868     165 166 1.000
869     165 167 1.000
870     166 167 1.000
871     166 168 1.000
872     167 168 1.000
873     167 169 1.000
874     168 169 1.000
875     168 170 1.000
876     169 170 1.000