ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1d2sA_Ca_8.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 12163 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
3 #PDB: 1d2s
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: Ca
8 #CUTOFF: 8.0
9 1 2 1.000
10 1 3 1.000
11 1 148 1.000
12 1 149 1.000
13 2 3 1.000
14 2 4 1.000
15 2 148 1.000
16 2 149 1.000
17 2 169 1.000
18 2 170 1.000
19 3 4 1.000
20 3 5 1.000
21 3 146 1.000
22 3 147 1.000
23 3 148 1.000
24 3 149 1.000
25 3 169 1.000
26 3 170 1.000
27 4 5 1.000
28 4 6 1.000
29 4 146 1.000
30 4 147 1.000
31 4 148 1.000
32 4 167 1.000
33 4 168 1.000
34 4 169 1.000
35 4 170 1.000
36 5 6 1.000
37 5 7 1.000
38 5 8 1.000
39 5 144 1.000
40 5 145 1.000
41 5 146 1.000
42 5 147 1.000
43 5 167 1.000
44 5 168 1.000
45 5 169 1.000
46 5 170 1.000
47 6 7 1.000
48 6 8 1.000
49 6 14 1.000
50 6 15 1.000
51 6 43 1.000
52 6 125 1.000
53 6 126 1.000
54 6 143 1.000
55 6 144 1.000
56 6 145 1.000
57 6 146 1.000
58 6 147 1.000
59 7 8 1.000
60 7 9 1.000
61 7 10 1.000
62 7 11 1.000
63 7 14 1.000
64 7 15 1.000
65 7 126 1.000
66 7 142 1.000
67 7 143 1.000
68 7 144 1.000
69 7 145 1.000
70 8 9 1.000
71 8 10 1.000
72 8 11 1.000
73 8 15 1.000
74 8 165 1.000
75 8 168 1.000
76 9 10 1.000
77 9 11 1.000
78 10 11 1.000
79 10 12 1.000
80 10 142 1.000
81 11 12 1.000
82 11 13 1.000
83 11 14 1.000
84 11 126 1.000
85 11 127 1.000
86 11 141 1.000
87 11 142 1.000
88 11 143 1.000
89 12 13 1.000
90 12 14 1.000
91 12 127 1.000
92 12 141 1.000
93 12 142 1.000
94 13 14 1.000
95 13 15 1.000
96 13 126 1.000
97 13 127 1.000
98 13 128 1.000
99 13 129 1.000
100 14 15 1.000
101 14 16 1.000
102 14 17 1.000
103 14 124 1.000
104 14 125 1.000
105 14 126 1.000
106 14 127 1.000
107 14 128 1.000
108 14 129 1.000
109 14 163 1.000
110 14 164 1.000
111 15 16 1.000
112 15 17 1.000
113 15 124 1.000
114 15 125 1.000
115 15 126 1.000
116 15 127 1.000
117 15 163 1.000
118 15 164 1.000
119 15 165 1.000
120 15 166 1.000
121 15 167 1.000
122 16 17 1.000
123 16 18 1.000
124 16 124 1.000
125 16 125 1.000
126 16 126 1.000
127 16 161 1.000
128 16 162 1.000
129 16 163 1.000
130 16 164 1.000
131 16 167 1.000
132 17 18 1.000
133 17 19 1.000
134 17 122 1.000
135 17 123 1.000
136 17 124 1.000
137 17 125 1.000
138 17 161 1.000
139 17 162 1.000
140 17 163 1.000
141 18 19 1.000
142 18 20 1.000
143 18 122 1.000
144 18 123 1.000
145 18 124 1.000
146 18 158 1.000
147 18 159 1.000
148 18 160 1.000
149 18 161 1.000
150 18 162 1.000
151 19 20 1.000
152 19 21 1.000
153 19 120 1.000
154 19 121 1.000
155 19 122 1.000
156 19 123 1.000
157 19 158 1.000
158 19 159 1.000
159 19 160 1.000
160 19 161 1.000
161 20 21 1.000
162 20 22 1.000
163 20 25 1.000
164 20 120 1.000
165 20 121 1.000
166 20 122 1.000
167 20 154 1.000
168 20 157 1.000
169 20 158 1.000
170 20 159 1.000
171 20 160 1.000
172 21 22 1.000
173 21 23 1.000
174 21 24 1.000
175 21 25 1.000
176 21 119 1.000
177 21 120 1.000
178 21 121 1.000
179 21 157 1.000
180 21 158 1.000
181 21 159 1.000
182 22 23 1.000
183 22 24 1.000
184 22 25 1.000
185 22 118 1.000
186 22 119 1.000
187 22 120 1.000
188 22 121 1.000
189 22 157 1.000
190 23 24 1.000
191 23 25 1.000
192 23 119 1.000
193 24 25 1.000
194 24 26 1.000
195 24 156 1.000
196 24 157 1.000
197 25 26 1.000
198 25 27 1.000
199 25 28 1.000
200 25 153 1.000
201 25 154 1.000
202 25 156 1.000
203 25 157 1.000
204 26 27 1.000
205 26 28 1.000
206 26 154 1.000
207 27 28 1.000
208 27 29 1.000
209 27 153 1.000
210 27 154 1.000
211 28 29 1.000
212 28 30 1.000
213 28 94 1.000
214 28 95 1.000
215 28 153 1.000
216 28 154 1.000
217 29 30 1.000
218 29 31 1.000
219 29 92 1.000
220 29 93 1.000
221 29 94 1.000
222 29 95 1.000
223 29 152 1.000
224 29 153 1.000
225 29 154 1.000
226 30 31 1.000
227 30 32 1.000
228 30 92 1.000
229 30 93 1.000
230 30 94 1.000
231 30 150 1.000
232 30 151 1.000
233 30 152 1.000
234 30 153 1.000
235 31 32 1.000
236 31 33 1.000
237 31 90 1.000
238 31 91 1.000
239 31 92 1.000
240 31 93 1.000
241 31 149 1.000
242 31 150 1.000
243 31 151 1.000
244 31 152 1.000
245 32 33 1.000
246 32 34 1.000
247 32 90 1.000
248 32 91 1.000
249 32 92 1.000
250 32 147 1.000
251 32 148 1.000
252 32 149 1.000
253 32 150 1.000
254 32 151 1.000
255 33 34 1.000
256 33 35 1.000
257 33 88 1.000
258 33 89 1.000
259 33 90 1.000
260 33 91 1.000
261 33 147 1.000
262 33 148 1.000
263 33 149 1.000
264 33 150 1.000
265 34 35 1.000
266 34 36 1.000
267 34 88 1.000
268 34 89 1.000
269 34 90 1.000
270 34 91 1.000
271 34 145 1.000
272 34 146 1.000
273 34 147 1.000
274 34 148 1.000
275 35 36 1.000
276 35 37 1.000
277 35 83 1.000
278 35 84 1.000
279 35 85 1.000
280 35 86 1.000
281 35 87 1.000
282 35 88 1.000
283 35 89 1.000
284 35 145 1.000
285 35 146 1.000
286 35 147 1.000
287 36 37 1.000
288 36 38 1.000
289 36 83 1.000
290 36 84 1.000
291 36 85 1.000
292 36 86 1.000
293 36 87 1.000
294 36 88 1.000
295 36 144 1.000
296 36 145 1.000
297 36 146 1.000
298 37 38 1.000
299 37 39 1.000
300 37 83 1.000
301 37 84 1.000
302 37 85 1.000
303 37 86 1.000
304 37 144 1.000
305 37 145 1.000
306 38 39 1.000
307 38 40 1.000
308 38 41 1.000
309 38 62 1.000
310 38 84 1.000
311 38 143 1.000
312 38 144 1.000
313 38 145 1.000
314 39 40 1.000
315 39 41 1.000
316 39 59 1.000
317 39 60 1.000
318 39 61 1.000
319 39 62 1.000
320 39 63 1.000
321 39 83 1.000
322 39 84 1.000
323 40 41 1.000
324 40 42 1.000
325 40 58 1.000
326 40 59 1.000
327 40 60 1.000
328 40 61 1.000
329 40 62 1.000
330 40 139 1.000
331 40 140 1.000
332 40 141 1.000
333 40 142 1.000
334 40 143 1.000
335 41 42 1.000
336 41 43 1.000
337 41 58 1.000
338 41 59 1.000
339 41 60 1.000
340 41 126 1.000
341 41 139 1.000
342 41 140 1.000
343 41 141 1.000
344 41 142 1.000
345 41 143 1.000
346 41 144 1.000
347 42 43 1.000
348 42 44 1.000
349 42 45 1.000
350 42 56 1.000
351 42 57 1.000
352 42 58 1.000
353 42 59 1.000
354 42 125 1.000
355 42 126 1.000
356 42 127 1.000
357 42 128 1.000
358 42 140 1.000
359 42 141 1.000
360 42 142 1.000
361 42 143 1.000
362 43 44 1.000
363 43 45 1.000
364 43 56 1.000
365 43 57 1.000
366 43 58 1.000
367 43 59 1.000
368 43 125 1.000
369 43 126 1.000
370 43 127 1.000
371 43 143 1.000
372 44 45 1.000
373 44 46 1.000
374 44 56 1.000
375 44 57 1.000
376 44 58 1.000
377 44 123 1.000
378 44 124 1.000
379 44 125 1.000
380 44 126 1.000
381 44 127 1.000
382 44 128 1.000
383 45 46 1.000
384 45 47 1.000
385 45 54 1.000
386 45 55 1.000
387 45 56 1.000
388 45 57 1.000
389 45 123 1.000
390 45 124 1.000
391 45 125 1.000
392 45 126 1.000
393 45 127 1.000
394 45 128 1.000
395 45 129 1.000
396 46 47 1.000
397 46 48 1.000
398 46 54 1.000
399 46 55 1.000
400 46 56 1.000
401 46 121 1.000
402 46 122 1.000
403 46 123 1.000
404 46 124 1.000
405 47 48 1.000
406 47 49 1.000
407 47 50 1.000
408 47 53 1.000
409 47 54 1.000
410 47 55 1.000
411 47 121 1.000
412 47 122 1.000
413 47 123 1.000
414 48 49 1.000
415 48 50 1.000
416 48 52 1.000
417 48 53 1.000
418 48 54 1.000
419 48 118 1.000
420 48 119 1.000
421 48 120 1.000
422 48 121 1.000
423 48 122 1.000
424 49 50 1.000
425 49 51 1.000
426 49 52 1.000
427 49 53 1.000
428 49 54 1.000
429 49 118 1.000
430 50 51 1.000
431 50 52 1.000
432 50 53 1.000
433 50 54 1.000
434 50 129 1.000
435 50 130 1.000
436 51 52 1.000
437 51 53 1.000
438 51 54 1.000
439 52 53 1.000
440 52 54 1.000
441 52 69 1.000
442 52 70 1.000
443 52 71 1.000
444 53 54 1.000
445 53 55 1.000
446 53 68 1.000
447 53 69 1.000
448 53 70 1.000
449 53 71 1.000
450 54 55 1.000
451 54 56 1.000
452 54 68 1.000
453 54 69 1.000
454 54 70 1.000
455 55 56 1.000
456 55 57 1.000
457 55 66 1.000
458 55 67 1.000
459 55 68 1.000
460 55 69 1.000
461 56 57 1.000
462 56 58 1.000
463 56 65 1.000
464 56 66 1.000
465 56 67 1.000
466 56 68 1.000
467 56 128 1.000
468 57 58 1.000
469 57 59 1.000
470 57 64 1.000
471 57 65 1.000
472 57 66 1.000
473 57 67 1.000
474 58 59 1.000
475 58 60 1.000
476 58 64 1.000
477 58 65 1.000
478 58 66 1.000
479 59 60 1.000
480 59 61 1.000
481 59 62 1.000
482 59 63 1.000
483 59 64 1.000
484 59 65 1.000
485 59 83 1.000
486 60 61 1.000
487 60 62 1.000
488 60 63 1.000
489 60 64 1.000
490 60 65 1.000
491 60 78 1.000
492 60 139 1.000
493 61 62 1.000
494 61 63 1.000
495 61 82 1.000
496 62 63 1.000
497 62 64 1.000
498 62 81 1.000
499 62 82 1.000
500 62 83 1.000
501 62 84 1.000
502 63 64 1.000
503 63 65 1.000
504 63 78 1.000
505 63 79 1.000
506 63 80 1.000
507 63 81 1.000
508 63 82 1.000
509 63 83 1.000
510 63 84 1.000
511 64 65 1.000
512 64 66 1.000
513 64 78 1.000
514 64 79 1.000
515 64 80 1.000
516 64 81 1.000
517 64 82 1.000
518 64 83 1.000
519 65 66 1.000
520 65 67 1.000
521 65 76 1.000
522 65 77 1.000
523 65 78 1.000
524 65 79 1.000
525 66 67 1.000
526 66 68 1.000
527 66 75 1.000
528 66 76 1.000
529 66 77 1.000
530 66 78 1.000
531 67 68 1.000
532 67 69 1.000
533 67 74 1.000
534 67 75 1.000
535 67 76 1.000
536 67 77 1.000
537 67 135 1.000
538 67 136 1.000
539 67 137 1.000
540 68 69 1.000
541 68 70 1.000
542 68 73 1.000
543 68 74 1.000
544 68 75 1.000
545 68 76 1.000
546 69 70 1.000
547 69 71 1.000
548 69 72 1.000
549 69 73 1.000
550 69 74 1.000
551 69 75 1.000
552 70 71 1.000
553 70 72 1.000
554 70 73 1.000
555 70 74 1.000
556 70 115 1.000
557 70 116 1.000
558 71 72 1.000
559 71 73 1.000
560 72 73 1.000
561 72 74 1.000
562 72 114 1.000
563 72 115 1.000
564 72 116 1.000
565 72 117 1.000
566 73 74 1.000
567 73 75 1.000
568 73 114 1.000
569 73 115 1.000
570 73 116 1.000
571 74 75 1.000
572 74 76 1.000
573 75 76 1.000
574 75 77 1.000
575 75 136 1.000
576 76 77 1.000
577 76 78 1.000
578 76 136 1.000
579 76 137 1.000
580 77 78 1.000
581 77 79 1.000
582 78 79 1.000
583 78 80 1.000
584 79 80 1.000
585 79 81 1.000
586 79 109 1.000
587 79 110 1.000
588 80 81 1.000
589 80 82 1.000
590 80 104 1.000
591 80 109 1.000
592 80 110 1.000
593 81 82 1.000
594 81 83 1.000
595 82 83 1.000
596 82 84 1.000
597 82 85 1.000
598 83 84 1.000
599 83 85 1.000
600 83 86 1.000
601 83 87 1.000
602 83 89 1.000
603 84 85 1.000
604 84 86 1.000
605 84 87 1.000
606 85 86 1.000
607 85 87 1.000
608 86 87 1.000
609 86 88 1.000
610 87 88 1.000
611 87 89 1.000
612 88 89 1.000
613 88 90 1.000
614 89 90 1.000
615 89 91 1.000
616 89 104 1.000
617 89 105 1.000
618 90 91 1.000
619 90 92 1.000
620 90 103 1.000
621 90 104 1.000
622 90 105 1.000
623 90 106 1.000
624 91 92 1.000
625 91 93 1.000
626 91 102 1.000
627 91 103 1.000
628 91 104 1.000
629 91 105 1.000
630 91 106 1.000
631 92 93 1.000
632 92 94 1.000
633 92 101 1.000
634 92 102 1.000
635 92 103 1.000
636 92 104 1.000
637 93 94 1.000
638 93 95 1.000
639 93 100 1.000
640 93 101 1.000
641 93 102 1.000
642 93 103 1.000
643 94 95 1.000
644 94 96 1.000
645 94 100 1.000
646 94 101 1.000
647 94 102 1.000
648 95 96 1.000
649 95 97 1.000
650 95 98 1.000
651 95 99 1.000
652 95 100 1.000
653 95 101 1.000
654 96 97 1.000
655 96 98 1.000
656 96 99 1.000
657 96 100 1.000
658 96 101 1.000
659 97 98 1.000
660 97 99 1.000
661 97 116 1.000
662 98 99 1.000
663 98 100 1.000
664 98 113 1.000
665 98 114 1.000
666 98 115 1.000
667 98 116 1.000
668 98 117 1.000
669 99 100 1.000
670 99 101 1.000
671 99 111 1.000
672 99 112 1.000
673 99 113 1.000
674 99 114 1.000
675 99 115 1.000
676 99 116 1.000
677 100 101 1.000
678 100 102 1.000
679 100 111 1.000
680 100 112 1.000
681 100 113 1.000
682 100 115 1.000
683 100 116 1.000
684 101 102 1.000
685 101 103 1.000
686 101 108 1.000
687 101 109 1.000
688 101 110 1.000
689 101 111 1.000
690 101 112 1.000
691 102 103 1.000
692 102 104 1.000
693 102 108 1.000
694 102 109 1.000
695 102 110 1.000
696 102 111 1.000
697 103 104 1.000
698 103 105 1.000
699 103 106 1.000
700 103 107 1.000
701 103 108 1.000
702 103 109 1.000
703 103 110 1.000
704 104 105 1.000
705 104 106 1.000
706 104 107 1.000
707 104 108 1.000
708 104 109 1.000
709 105 106 1.000
710 105 107 1.000
711 106 107 1.000
712 106 108 1.000
713 107 108 1.000
714 107 109 1.000
715 108 109 1.000
716 108 110 1.000
717 108 111 1.000
718 109 110 1.000
719 109 111 1.000
720 110 111 1.000
721 110 112 1.000
722 111 112 1.000
723 111 113 1.000
724 112 113 1.000
725 112 114 1.000
726 112 115 1.000
727 113 114 1.000
728 113 115 1.000
729 114 115 1.000
730 114 116 1.000
731 114 117 1.000
732 115 116 1.000
733 115 117 1.000
734 116 117 1.000
735 118 119 1.000
736 118 120 1.000
737 118 121 1.000
738 119 120 1.000
739 119 121 1.000
740 120 121 1.000
741 120 122 1.000
742 121 122 1.000
743 121 123 1.000
744 122 123 1.000
745 122 124 1.000
746 123 124 1.000
747 123 125 1.000
748 123 152 1.000
749 124 125 1.000
750 124 126 1.000
751 124 127 1.000
752 124 128 1.000
753 124 129 1.000
754 125 126 1.000
755 125 127 1.000
756 125 128 1.000
757 126 127 1.000
758 126 128 1.000
759 126 141 1.000
760 126 142 1.000
761 126 143 1.000
762 127 128 1.000
763 127 129 1.000
764 127 141 1.000
765 127 142 1.000
766 128 129 1.000
767 128 130 1.000
768 128 131 1.000
769 128 132 1.000
770 128 141 1.000
771 129 130 1.000
772 129 131 1.000
773 130 131 1.000
774 130 132 1.000
775 130 134 1.000
776 131 132 1.000
777 131 133 1.000
778 131 134 1.000
779 131 135 1.000
780 132 133 1.000
781 132 134 1.000
782 132 135 1.000
783 132 138 1.000
784 132 139 1.000
785 132 140 1.000
786 132 141 1.000
787 133 134 1.000
788 133 135 1.000
789 133 137 1.000
790 133 138 1.000
791 133 139 1.000
792 134 135 1.000
793 134 136 1.000
794 134 138 1.000
795 135 136 1.000
796 135 137 1.000
797 135 138 1.000
798 135 139 1.000
799 136 137 1.000
800 136 138 1.000
801 137 138 1.000
802 137 139 1.000
803 138 139 1.000
804 138 140 1.000
805 139 140 1.000
806 139 141 1.000
807 140 141 1.000
808 140 142 1.000
809 141 142 1.000
810 141 143 1.000
811 142 143 1.000
812 142 144 1.000
813 143 144 1.000
814 143 145 1.000
815 144 145 1.000
816 144 146 1.000
817 145 146 1.000
818 145 147 1.000
819 146 147 1.000
820 146 148 1.000
821 146 170 1.000
822 147 148 1.000
823 147 149 1.000
824 147 150 1.000
825 148 149 1.000
826 148 150 1.000
827 149 150 1.000
828 149 151 1.000
829 150 151 1.000
830 150 152 1.000
831 151 152 1.000
832 151 153 1.000
833 151 154 1.000
834 151 155 1.000
835 152 153 1.000
836 152 154 1.000
837 152 155 1.000
838 153 154 1.000
839 153 155 1.000
840 154 155 1.000
841 154 156 1.000
842 154 157 1.000
843 154 158 1.000
844 155 156 1.000
845 155 157 1.000
846 155 158 1.000
847 156 157 1.000
848 156 158 1.000
849 157 158 1.000
850 157 159 1.000
851 158 159 1.000
852 158 160 1.000
853 158 161 1.000
854 159 160 1.000
855 159 161 1.000
856 160 161 1.000
857 160 162 1.000
858 161 162 1.000
859 161 163 1.000
860 162 163 1.000
861 162 164 1.000
862 163 164 1.000
863 163 165 1.000
864 163 166 1.000
865 163 167 1.000
866 164 165 1.000
867 164 166 1.000
868 165 166 1.000
869 165 167 1.000
870 166 167 1.000
871 166 168 1.000
872 167 168 1.000
873 167 169 1.000
874 168 169 1.000
875 168 170 1.000
876 169 170 1.000