ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1d2sA_Cb_8.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 11880 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
3 #PDB: 1d2s
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: Cb
8 #CUTOFF: 8.0
9 1 2 1.000
10 1 3 1.000
11 1 33 1.000
12 1 148 1.000
13 1 149 1.000
14 2 3 1.000
15 2 4 1.000
16 2 148 1.000
17 2 169 1.000
18 3 4 1.000
19 3 35 1.000
20 3 146 1.000
21 3 147 1.000
22 3 148 1.000
23 3 169 1.000
24 3 170 1.000
25 4 5 1.000
26 4 6 1.000
27 4 15 1.000
28 4 146 1.000
29 4 147 1.000
30 4 148 1.000
31 4 167 1.000
32 4 168 1.000
33 4 169 1.000
34 4 170 1.000
35 5 6 1.000
36 5 7 1.000
37 5 8 1.000
38 5 15 1.000
39 5 145 1.000
40 5 146 1.000
41 5 147 1.000
42 5 167 1.000
43 5 168 1.000
44 5 169 1.000
45 5 170 1.000
46 6 7 1.000
47 6 15 1.000
48 6 34 1.000
49 6 36 1.000
50 6 43 1.000
51 6 125 1.000
52 6 126 1.000
53 6 143 1.000
54 6 144 1.000
55 6 145 1.000
56 6 146 1.000
57 6 147 1.000
58 7 8 1.000
59 7 9 1.000
60 7 10 1.000
61 7 11 1.000
62 7 15 1.000
63 7 126 1.000
64 7 142 1.000
65 7 143 1.000
66 7 144 1.000
67 7 145 1.000
68 8 9 1.000
69 8 11 1.000
70 8 15 1.000
71 8 165 1.000
72 8 168 1.000
73 9 10 1.000
74 9 11 1.000
75 10 11 1.000
76 10 12 1.000
77 10 142 1.000
78 11 12 1.000
79 11 13 1.000
80 11 126 1.000
81 11 127 1.000
82 11 141 1.000
83 11 142 1.000
84 12 13 1.000
85 12 141 1.000
86 12 142 1.000
87 13 14 1.000
88 13 127 1.000
89 13 164 1.000
90 14 15 1.000
91 14 16 1.000
92 14 17 1.000
93 14 42 1.000
94 14 45 1.000
95 14 124 1.000
96 14 125 1.000
97 14 126 1.000
98 14 127 1.000
99 14 128 1.000
100 14 129 1.000
101 14 164 1.000
102 15 16 1.000
103 15 125 1.000
104 15 126 1.000
105 15 127 1.000
106 15 163 1.000
107 15 164 1.000
108 15 165 1.000
109 15 167 1.000
110 16 17 1.000
111 16 18 1.000
112 16 124 1.000
113 16 125 1.000
114 16 161 1.000
115 16 162 1.000
116 16 163 1.000
117 16 167 1.000
118 17 18 1.000
119 17 19 1.000
120 17 122 1.000
121 17 123 1.000
122 17 124 1.000
123 17 125 1.000
124 17 129 1.000
125 17 161 1.000
126 17 162 1.000
127 17 163 1.000
128 18 19 1.000
129 18 20 1.000
130 18 122 1.000
131 18 123 1.000
132 18 124 1.000
133 18 152 1.000
134 18 153 1.000
135 18 158 1.000
136 18 160 1.000
137 18 161 1.000
138 19 20 1.000
139 19 120 1.000
140 19 121 1.000
141 19 122 1.000
142 19 123 1.000
143 19 158 1.000
144 19 159 1.000
145 19 160 1.000
146 19 161 1.000
147 20 21 1.000
148 20 22 1.000
149 20 24 1.000
150 20 25 1.000
151 20 120 1.000
152 20 121 1.000
153 20 122 1.000
154 20 123 1.000
155 20 153 1.000
156 20 154 1.000
157 20 157 1.000
158 20 158 1.000
159 20 159 1.000
160 21 22 1.000
161 21 23 1.000
162 21 24 1.000
163 21 25 1.000
164 21 119 1.000
165 21 120 1.000
166 21 157 1.000
167 21 158 1.000
168 21 159 1.000
169 22 23 1.000
170 22 24 1.000
171 22 25 1.000
172 22 48 1.000
173 22 118 1.000
174 22 119 1.000
175 22 120 1.000
176 22 121 1.000
177 22 157 1.000
178 23 24 1.000
179 23 25 1.000
180 23 119 1.000
181 24 25 1.000
182 24 26 1.000
183 24 154 1.000
184 24 156 1.000
185 24 157 1.000
186 25 26 1.000
187 25 27 1.000
188 25 28 1.000
189 25 121 1.000
190 25 153 1.000
191 25 154 1.000
192 25 157 1.000
193 26 27 1.000
194 26 28 1.000
195 26 154 1.000
196 26 156 1.000
197 26 157 1.000
198 27 28 1.000
199 27 29 1.000
200 27 153 1.000
201 27 154 1.000
202 28 29 1.000
203 28 94 1.000
204 28 95 1.000
205 28 153 1.000
206 28 154 1.000
207 29 30 1.000
208 29 31 1.000
209 29 92 1.000
210 29 93 1.000
211 29 94 1.000
212 29 95 1.000
213 29 151 1.000
214 29 153 1.000
215 30 31 1.000
216 30 32 1.000
217 30 44 1.000
218 30 92 1.000
219 30 93 1.000
220 30 94 1.000
221 30 123 1.000
222 30 150 1.000
223 30 151 1.000
224 30 152 1.000
225 30 153 1.000
226 31 32 1.000
227 31 90 1.000
228 31 91 1.000
229 31 92 1.000
230 31 93 1.000
231 31 149 1.000
232 31 150 1.000
233 31 151 1.000
234 32 33 1.000
235 32 34 1.000
236 32 90 1.000
237 32 91 1.000
238 32 147 1.000
239 32 148 1.000
240 32 149 1.000
241 32 150 1.000
242 32 151 1.000
243 33 34 1.000
244 33 35 1.000
245 33 88 1.000
246 33 89 1.000
247 33 90 1.000
248 33 91 1.000
249 33 147 1.000
250 33 148 1.000
251 33 149 1.000
252 33 150 1.000
253 34 35 1.000
254 34 36 1.000
255 34 43 1.000
256 34 83 1.000
257 34 88 1.000
258 34 89 1.000
259 34 91 1.000
260 34 145 1.000
261 34 146 1.000
262 34 147 1.000
263 35 36 1.000
264 35 86 1.000
265 35 87 1.000
266 35 88 1.000
267 35 89 1.000
268 35 145 1.000
269 35 146 1.000
270 35 148 1.000
271 35 170 1.000
272 36 37 1.000
273 36 38 1.000
274 36 59 1.000
275 36 83 1.000
276 36 84 1.000
277 36 86 1.000
278 36 143 1.000
279 36 144 1.000
280 36 145 1.000
281 36 146 1.000
282 37 38 1.000
283 37 39 1.000
284 37 84 1.000
285 37 85 1.000
286 37 86 1.000
287 37 144 1.000
288 37 145 1.000
289 38 39 1.000
290 38 40 1.000
291 38 41 1.000
292 38 59 1.000
293 38 62 1.000
294 38 84 1.000
295 38 142 1.000
296 38 143 1.000
297 38 144 1.000
298 38 145 1.000
299 39 40 1.000
300 39 59 1.000
301 39 60 1.000
302 39 61 1.000
303 39 62 1.000
304 39 84 1.000
305 40 41 1.000
306 40 59 1.000
307 40 60 1.000
308 40 61 1.000
309 40 62 1.000
310 40 139 1.000
311 40 140 1.000
312 40 143 1.000
313 41 42 1.000
314 41 43 1.000
315 41 58 1.000
316 41 59 1.000
317 41 60 1.000
318 41 126 1.000
319 41 139 1.000
320 41 140 1.000
321 41 141 1.000
322 41 142 1.000
323 41 143 1.000
324 42 43 1.000
325 42 44 1.000
326 42 45 1.000
327 42 56 1.000
328 42 57 1.000
329 42 58 1.000
330 42 124 1.000
331 42 126 1.000
332 42 127 1.000
333 42 128 1.000
334 42 139 1.000
335 42 141 1.000
336 42 142 1.000
337 42 143 1.000
338 43 44 1.000
339 43 57 1.000
340 43 58 1.000
341 43 59 1.000
342 43 91 1.000
343 43 125 1.000
344 43 126 1.000
345 43 143 1.000
346 43 147 1.000
347 44 45 1.000
348 44 46 1.000
349 44 56 1.000
350 44 57 1.000
351 44 58 1.000
352 44 123 1.000
353 44 124 1.000
354 44 125 1.000
355 44 126 1.000
356 44 127 1.000
357 44 152 1.000
358 45 46 1.000
359 45 47 1.000
360 45 54 1.000
361 45 55 1.000
362 45 56 1.000
363 45 57 1.000
364 45 122 1.000
365 45 123 1.000
366 45 124 1.000
367 45 126 1.000
368 45 127 1.000
369 45 128 1.000
370 45 129 1.000
371 46 47 1.000
372 46 54 1.000
373 46 55 1.000
374 46 56 1.000
375 46 121 1.000
376 46 122 1.000
377 46 123 1.000
378 46 124 1.000
379 46 129 1.000
380 47 48 1.000
381 47 49 1.000
382 47 50 1.000
383 47 53 1.000
384 47 54 1.000
385 47 55 1.000
386 47 121 1.000
387 47 122 1.000
388 47 129 1.000
389 48 49 1.000
390 48 52 1.000
391 48 53 1.000
392 48 54 1.000
393 48 118 1.000
394 48 119 1.000
395 48 120 1.000
396 48 121 1.000
397 48 122 1.000
398 49 50 1.000
399 49 51 1.000
400 49 52 1.000
401 49 53 1.000
402 49 54 1.000
403 49 118 1.000
404 50 51 1.000
405 50 52 1.000
406 50 54 1.000
407 50 129 1.000
408 50 130 1.000
409 50 134 1.000
410 51 52 1.000
411 51 53 1.000
412 51 54 1.000
413 51 130 1.000
414 52 53 1.000
415 52 54 1.000
416 52 69 1.000
417 52 70 1.000
418 52 71 1.000
419 53 54 1.000
420 53 69 1.000
421 53 70 1.000
422 53 71 1.000
423 53 118 1.000
424 54 55 1.000
425 54 56 1.000
426 54 68 1.000
427 54 69 1.000
428 54 70 1.000
429 54 129 1.000
430 54 130 1.000
431 55 56 1.000
432 55 57 1.000
433 55 66 1.000
434 55 67 1.000
435 55 68 1.000
436 55 69 1.000
437 55 70 1.000
438 55 100 1.000
439 56 57 1.000
440 56 58 1.000
441 56 65 1.000
442 56 66 1.000
443 56 67 1.000
444 56 68 1.000
445 56 128 1.000
446 56 135 1.000
447 57 58 1.000
448 57 64 1.000
449 57 65 1.000
450 57 66 1.000
451 57 91 1.000
452 57 93 1.000
453 57 102 1.000
454 58 59 1.000
455 58 60 1.000
456 58 64 1.000
457 58 65 1.000
458 58 66 1.000
459 58 139 1.000
460 58 143 1.000
461 59 60 1.000
462 59 61 1.000
463 59 62 1.000
464 59 63 1.000
465 59 64 1.000
466 59 65 1.000
467 59 83 1.000
468 59 84 1.000
469 59 143 1.000
470 60 61 1.000
471 60 62 1.000
472 60 63 1.000
473 60 65 1.000
474 60 78 1.000
475 60 139 1.000
476 61 62 1.000
477 61 63 1.000
478 61 82 1.000
479 62 63 1.000
480 62 82 1.000
481 62 83 1.000
482 62 84 1.000
483 63 64 1.000
484 63 65 1.000
485 63 78 1.000
486 63 79 1.000
487 63 80 1.000
488 63 81 1.000
489 63 82 1.000
490 63 83 1.000
491 64 65 1.000
492 64 66 1.000
493 64 78 1.000
494 64 79 1.000
495 64 80 1.000
496 64 83 1.000
497 64 91 1.000
498 64 102 1.000
499 64 104 1.000
500 64 109 1.000
501 64 110 1.000
502 65 66 1.000
503 65 67 1.000
504 65 76 1.000
505 65 77 1.000
506 65 78 1.000
507 65 79 1.000
508 65 139 1.000
509 66 67 1.000
510 66 68 1.000
511 66 75 1.000
512 66 76 1.000
513 66 77 1.000
514 66 78 1.000
515 66 79 1.000
516 66 100 1.000
517 66 102 1.000
518 66 110 1.000
519 66 112 1.000
520 67 68 1.000
521 67 69 1.000
522 67 75 1.000
523 67 76 1.000
524 67 77 1.000
525 67 135 1.000
526 67 136 1.000
527 67 137 1.000
528 68 69 1.000
529 68 70 1.000
530 68 73 1.000
531 68 74 1.000
532 68 75 1.000
533 68 77 1.000
534 68 100 1.000
535 68 112 1.000
536 68 115 1.000
537 69 70 1.000
538 69 73 1.000
539 69 74 1.000
540 69 136 1.000
541 70 71 1.000
542 70 72 1.000
543 70 73 1.000
544 70 74 1.000
545 70 115 1.000
546 70 116 1.000
547 71 72 1.000
548 71 117 1.000
549 72 73 1.000
550 72 98 1.000
551 72 114 1.000
552 72 115 1.000
553 72 116 1.000
554 72 117 1.000
555 73 74 1.000
556 73 75 1.000
557 73 112 1.000
558 73 114 1.000
559 73 115 1.000
560 73 116 1.000
561 74 75 1.000
562 74 136 1.000
563 75 76 1.000
564 75 77 1.000
565 75 112 1.000
566 75 115 1.000
567 75 136 1.000
568 76 77 1.000
569 76 78 1.000
570 76 136 1.000
571 76 137 1.000
572 77 78 1.000
573 77 79 1.000
574 77 110 1.000
575 77 112 1.000
576 78 79 1.000
577 78 80 1.000
578 78 110 1.000
579 79 80 1.000
580 79 102 1.000
581 79 109 1.000
582 79 110 1.000
583 80 81 1.000
584 80 102 1.000
585 80 104 1.000
586 80 109 1.000
587 80 110 1.000
588 81 82 1.000
589 81 83 1.000
590 81 104 1.000
591 81 105 1.000
592 81 109 1.000
593 82 83 1.000
594 82 84 1.000
595 82 85 1.000
596 83 84 1.000
597 83 85 1.000
598 83 89 1.000
599 83 91 1.000
600 83 104 1.000
601 84 85 1.000
602 84 86 1.000
603 85 86 1.000
604 85 87 1.000
605 86 87 1.000
606 87 88 1.000
607 87 89 1.000
608 88 89 1.000
609 88 90 1.000
610 88 148 1.000
611 89 90 1.000
612 89 91 1.000
613 89 104 1.000
614 89 105 1.000
615 90 91 1.000
616 90 92 1.000
617 90 103 1.000
618 90 104 1.000
619 90 105 1.000
620 90 106 1.000
621 91 92 1.000
622 91 93 1.000
623 91 102 1.000
624 91 103 1.000
625 91 104 1.000
626 92 93 1.000
627 92 94 1.000
628 92 101 1.000
629 92 102 1.000
630 92 103 1.000
631 92 106 1.000
632 93 94 1.000
633 93 100 1.000
634 93 101 1.000
635 93 102 1.000
636 93 103 1.000
637 94 95 1.000
638 94 96 1.000
639 94 100 1.000
640 94 101 1.000
641 94 103 1.000
642 95 96 1.000
643 95 97 1.000
644 95 99 1.000
645 95 100 1.000
646 95 101 1.000
647 95 116 1.000
648 96 97 1.000
649 96 99 1.000
650 96 100 1.000
651 96 101 1.000
652 96 111 1.000
653 97 98 1.000
654 97 99 1.000
655 97 116 1.000
656 98 99 1.000
657 98 113 1.000
658 98 114 1.000
659 98 115 1.000
660 98 116 1.000
661 98 117 1.000
662 99 100 1.000
663 99 101 1.000
664 99 111 1.000
665 99 112 1.000
666 99 113 1.000
667 99 114 1.000
668 99 115 1.000
669 99 116 1.000
670 100 101 1.000
671 100 102 1.000
672 100 111 1.000
673 100 112 1.000
674 100 115 1.000
675 100 116 1.000
676 101 102 1.000
677 101 103 1.000
678 101 108 1.000
679 101 110 1.000
680 101 111 1.000
681 101 112 1.000
682 102 103 1.000
683 102 104 1.000
684 102 108 1.000
685 102 109 1.000
686 102 110 1.000
687 102 111 1.000
688 103 104 1.000
689 103 105 1.000
690 103 106 1.000
691 103 107 1.000
692 103 108 1.000
693 103 109 1.000
694 104 105 1.000
695 104 106 1.000
696 104 107 1.000
697 104 109 1.000
698 105 106 1.000
699 105 107 1.000
700 106 107 1.000
701 106 108 1.000
702 107 108 1.000
703 107 109 1.000
704 108 109 1.000
705 108 110 1.000
706 108 111 1.000
707 109 110 1.000
708 110 111 1.000
709 110 112 1.000
710 111 112 1.000
711 111 113 1.000
712 112 113 1.000
713 112 115 1.000
714 113 114 1.000
715 113 115 1.000
716 114 115 1.000
717 115 116 1.000
718 116 117 1.000
719 118 119 1.000
720 118 120 1.000
721 118 121 1.000
722 119 120 1.000
723 120 121 1.000
724 120 122 1.000
725 120 159 1.000
726 121 122 1.000
727 121 123 1.000
728 121 153 1.000
729 122 123 1.000
730 122 124 1.000
731 122 129 1.000
732 123 124 1.000
733 123 125 1.000
734 123 152 1.000
735 123 153 1.000
736 124 125 1.000
737 124 126 1.000
738 124 127 1.000
739 124 128 1.000
740 124 129 1.000
741 125 126 1.000
742 125 127 1.000
743 125 147 1.000
744 125 150 1.000
745 126 127 1.000
746 126 141 1.000
747 126 143 1.000
748 127 128 1.000
749 127 129 1.000
750 127 141 1.000
751 127 143 1.000
752 128 129 1.000
753 128 130 1.000
754 128 131 1.000
755 128 132 1.000
756 128 134 1.000
757 128 135 1.000
758 128 141 1.000
759 129 130 1.000
760 130 131 1.000
761 130 134 1.000
762 131 132 1.000
763 131 133 1.000
764 131 134 1.000
765 132 133 1.000
766 132 134 1.000
767 132 135 1.000
768 132 138 1.000
769 132 139 1.000
770 132 140 1.000
771 132 141 1.000
772 133 134 1.000
773 133 135 1.000
774 133 138 1.000
775 134 135 1.000
776 135 136 1.000
777 135 137 1.000
778 135 138 1.000
779 135 139 1.000
780 136 137 1.000
781 137 138 1.000
782 137 139 1.000
783 138 139 1.000
784 138 140 1.000
785 139 140 1.000
786 139 141 1.000
787 140 141 1.000
788 140 142 1.000
789 141 142 1.000
790 141 143 1.000
791 142 143 1.000
792 142 144 1.000
793 143 144 1.000
794 143 145 1.000
795 144 145 1.000
796 145 146 1.000
797 145 147 1.000
798 145 170 1.000
799 146 147 1.000
800 146 148 1.000
801 146 170 1.000
802 147 148 1.000
803 147 150 1.000
804 147 170 1.000
805 148 149 1.000
806 148 150 1.000
807 148 170 1.000
808 149 150 1.000
809 149 151 1.000
810 150 151 1.000
811 150 152 1.000
812 151 152 1.000
813 151 155 1.000
814 152 153 1.000
815 152 155 1.000
816 152 158 1.000
817 153 154 1.000
818 153 155 1.000
819 153 157 1.000
820 153 158 1.000
821 154 155 1.000
822 154 156 1.000
823 154 157 1.000
824 154 158 1.000
825 155 156 1.000
826 155 157 1.000
827 155 158 1.000
828 156 157 1.000
829 156 158 1.000
830 157 158 1.000
831 157 159 1.000
832 158 159 1.000
833 158 160 1.000
834 158 161 1.000
835 159 160 1.000
836 160 161 1.000
837 160 162 1.000
838 161 162 1.000
839 161 163 1.000
840 162 163 1.000
841 162 164 1.000
842 163 164 1.000
843 163 165 1.000
844 163 166 1.000
845 163 167 1.000
846 164 165 1.000
847 165 166 1.000
848 166 167 1.000
849 166 168 1.000
850 167 168 1.000
851 167 169 1.000
852 168 169 1.000
853 168 170 1.000
854 169 170 1.000