ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1d2sA_SC_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 9 months ago) by duarte
File size: 5055 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line User Rev File contents
1 duarte 884 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
3     #PDB: 1d2s
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: SC
8     #CUTOFF: 5.0
9     1 2 1.000
10     1 148 1.000
11     3 88 1.000
12     3 146 1.000
13     3 148 1.000
14     3 170 1.000
15     4 5 1.000
16     4 15 1.000
17     4 147 1.000
18     4 167 1.000
19     5 146 1.000
20     5 168 1.000
21     5 170 1.000
22     6 15 1.000
23     6 34 1.000
24     6 43 1.000
25     6 125 1.000
26     6 143 1.000
27     6 147 1.000
28     7 142 1.000
29     7 144 1.000
30     8 165 1.000
31     8 168 1.000
32     10 12 1.000
33     13 14 1.000
34     13 164 1.000
35     14 17 1.000
36     14 124 1.000
37     14 129 1.000
38     15 16 1.000
39     15 125 1.000
40     15 167 1.000
41     16 125 1.000
42     16 163 1.000
43     16 167 1.000
44     17 19 1.000
45     17 122 1.000
46     17 124 1.000
47     17 129 1.000
48     17 162 1.000
49     18 20 1.000
50     18 123 1.000
51     18 125 1.000
52     18 152 1.000
53     18 158 1.000
54     18 161 1.000
55     19 120 1.000
56     19 122 1.000
57     19 159 1.000
58     19 160 1.000
59     20 25 1.000
60     20 121 1.000
61     20 123 1.000
62     20 152 1.000
63     20 153 1.000
64     20 157 1.000
65     20 158 1.000
66     21 23 1.000
67     21 24 1.000
68     21 157 1.000
69     21 159 1.000
70     22 25 1.000
71     22 48 1.000
72     22 118 1.000
73     22 121 1.000
74     23 24 1.000
75     24 157 1.000
76     25 28 1.000
77     25 121 1.000
78     25 153 1.000
79     25 154 1.000
80     25 157 1.000
81     26 27 1.000
82     26 154 1.000
83     27 29 1.000
84     27 151 1.000
85     27 154 1.000
86     28 95 1.000
87     29 94 1.000
88     30 44 1.000
89     30 152 1.000
90     30 153 1.000
91     31 92 1.000
92     31 151 1.000
93     32 34 1.000
94     32 43 1.000
95     32 44 1.000
96     32 57 1.000
97     32 91 1.000
98     32 147 1.000
99     32 150 1.000
100     32 152 1.000
101     33 88 1.000
102     33 90 1.000
103     33 148 1.000
104     33 149 1.000
105     34 36 1.000
106     34 43 1.000
107     34 83 1.000
108     34 89 1.000
109     34 91 1.000
110     34 147 1.000
111     35 88 1.000
112     35 146 1.000
113     36 38 1.000
114     36 59 1.000
115     36 84 1.000
116     36 143 1.000
117     38 39 1.000
118     38 40 1.000
119     38 143 1.000
120     38 144 1.000
121     39 40 1.000
122     39 82 1.000
123     39 84 1.000
124     40 60 1.000
125     40 139 1.000
126     40 140 1.000
127     42 45 1.000
128     42 56 1.000
129     42 128 1.000
130     42 139 1.000
131     42 141 1.000
132     43 44 1.000
133     43 57 1.000
134     43 59 1.000
135     43 143 1.000
136     43 147 1.000
137     44 55 1.000
138     44 57 1.000
139     44 93 1.000
140     44 123 1.000
141     44 125 1.000
142     44 152 1.000
143     45 47 1.000
144     45 50 1.000
145     45 54 1.000
146     45 56 1.000
147     45 122 1.000
148     45 124 1.000
149     45 128 1.000
150     45 129 1.000
151     45 130 1.000
152     47 50 1.000
153     47 54 1.000
154     47 122 1.000
155     47 129 1.000
156     48 49 1.000
157     48 53 1.000
158     48 118 1.000
159     48 121 1.000
160     49 50 1.000
161     49 51 1.000
162     49 52 1.000
163     49 53 1.000
164     50 122 1.000
165     50 130 1.000
166     51 52 1.000
167     52 53 1.000
168     53 70 1.000
169     53 118 1.000
170     54 56 1.000
171     54 67 1.000
172     54 69 1.000
173     54 130 1.000
174     54 135 1.000
175     54 136 1.000
176     55 57 1.000
177     55 66 1.000
178     55 68 1.000
179     55 93 1.000
180     55 100 1.000
181     56 65 1.000
182     56 67 1.000
183     56 128 1.000
184     56 135 1.000
185     56 139 1.000
186     57 64 1.000
187     57 66 1.000
188     57 91 1.000
189     57 93 1.000
190     57 102 1.000
191     59 64 1.000
192     59 83 1.000
193     59 84 1.000
194     59 143 1.000
195     60 61 1.000
196     60 65 1.000
197     60 67 1.000
198     60 137 1.000
199     60 139 1.000
200     61 82 1.000
201     63 64 1.000
202     63 81 1.000
203     63 82 1.000
204     64 83 1.000
205     64 102 1.000
206     64 104 1.000
207     65 67 1.000
208     65 76 1.000
209     65 137 1.000
210     65 139 1.000
211     66 68 1.000
212     66 75 1.000
213     66 100 1.000
214     66 102 1.000
215     66 110 1.000
216     66 112 1.000
217     67 76 1.000
218     67 135 1.000
219     67 136 1.000
220     67 137 1.000
221     67 139 1.000
222     68 70 1.000
223     68 73 1.000
224     68 75 1.000
225     68 100 1.000
226     68 112 1.000
227     68 115 1.000
228     69 74 1.000
229     69 136 1.000
230     70 71 1.000
231     70 72 1.000
232     70 73 1.000
233     70 116 1.000
234     71 72 1.000
235     72 73 1.000
236     73 75 1.000
237     73 115 1.000
238     74 136 1.000
239     75 77 1.000
240     75 112 1.000
241     75 115 1.000
242     75 136 1.000
243     76 136 1.000
244     76 137 1.000
245     77 79 1.000
246     77 110 1.000
247     77 112 1.000
248     79 109 1.000
249     79 110 1.000
250     81 83 1.000
251     81 104 1.000
252     81 107 1.000
253     81 109 1.000
254     82 84 1.000
255     83 89 1.000
256     83 91 1.000
257     83 104 1.000
258     85 87 1.000
259     85 89 1.000
260     87 89 1.000
261     87 105 1.000
262     88 146 1.000
263     88 148 1.000
264     89 91 1.000
265     89 104 1.000
266     89 105 1.000
267     90 92 1.000
268     90 105 1.000
269     90 149 1.000
270     91 93 1.000
271     91 102 1.000
272     91 104 1.000
273     92 94 1.000
274     92 103 1.000
275     93 100 1.000
276     93 102 1.000
277     94 101 1.000
278     94 103 1.000
279     95 100 1.000
280     95 116 1.000
281     96 99 1.000
282     96 101 1.000
283     96 111 1.000
284     98 99 1.000
285     98 113 1.000
286     98 114 1.000
287     99 101 1.000
288     99 111 1.000
289     99 113 1.000
290     100 112 1.000
291     100 115 1.000
292     101 103 1.000
293     101 108 1.000
294     101 111 1.000
295     102 104 1.000
296     102 109 1.000
297     102 110 1.000
298     103 108 1.000
299     104 105 1.000
300     104 109 1.000
301     107 109 1.000
302     108 111 1.000
303     109 110 1.000
304     110 112 1.000
305     111 113 1.000
306     112 115 1.000
307     113 114 1.000
308     115 116 1.000
309     118 119 1.000
310     119 120 1.000
311     120 122 1.000
312     120 159 1.000
313     121 123 1.000
314     121 153 1.000
315     122 129 1.000
316     123 125 1.000
317     123 152 1.000
318     123 153 1.000
319     124 129 1.000
320     125 147 1.000
321     125 150 1.000
322     125 152 1.000
323     128 130 1.000
324     128 132 1.000
325     128 135 1.000
326     128 141 1.000
327     130 131 1.000
328     130 134 1.000
329     130 135 1.000
330     131 133 1.000
331     131 134 1.000
332     132 135 1.000
333     132 141 1.000
334     133 134 1.000
335     135 138 1.000
336     135 139 1.000
337     136 137 1.000
338     137 138 1.000
339     139 141 1.000
340     140 141 1.000
341     140 142 1.000
342     146 170 1.000
343     147 150 1.000
344     147 152 1.000
345     148 149 1.000
346     150 152 1.000
347     153 154 1.000
348     154 156 1.000
349     154 157 1.000
350     155 158 1.000
351     158 161 1.000
352     159 160 1.000
353     163 164 1.000
354     163 167 1.000
355     164 165 1.000