ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1d2sA_SC_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 5055 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
3 #PDB: 1d2s
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: SC
8 #CUTOFF: 5.0
9 1 2 1.000
10 1 148 1.000
11 3 88 1.000
12 3 146 1.000
13 3 148 1.000
14 3 170 1.000
15 4 5 1.000
16 4 15 1.000
17 4 147 1.000
18 4 167 1.000
19 5 146 1.000
20 5 168 1.000
21 5 170 1.000
22 6 15 1.000
23 6 34 1.000
24 6 43 1.000
25 6 125 1.000
26 6 143 1.000
27 6 147 1.000
28 7 142 1.000
29 7 144 1.000
30 8 165 1.000
31 8 168 1.000
32 10 12 1.000
33 13 14 1.000
34 13 164 1.000
35 14 17 1.000
36 14 124 1.000
37 14 129 1.000
38 15 16 1.000
39 15 125 1.000
40 15 167 1.000
41 16 125 1.000
42 16 163 1.000
43 16 167 1.000
44 17 19 1.000
45 17 122 1.000
46 17 124 1.000
47 17 129 1.000
48 17 162 1.000
49 18 20 1.000
50 18 123 1.000
51 18 125 1.000
52 18 152 1.000
53 18 158 1.000
54 18 161 1.000
55 19 120 1.000
56 19 122 1.000
57 19 159 1.000
58 19 160 1.000
59 20 25 1.000
60 20 121 1.000
61 20 123 1.000
62 20 152 1.000
63 20 153 1.000
64 20 157 1.000
65 20 158 1.000
66 21 23 1.000
67 21 24 1.000
68 21 157 1.000
69 21 159 1.000
70 22 25 1.000
71 22 48 1.000
72 22 118 1.000
73 22 121 1.000
74 23 24 1.000
75 24 157 1.000
76 25 28 1.000
77 25 121 1.000
78 25 153 1.000
79 25 154 1.000
80 25 157 1.000
81 26 27 1.000
82 26 154 1.000
83 27 29 1.000
84 27 151 1.000
85 27 154 1.000
86 28 95 1.000
87 29 94 1.000
88 30 44 1.000
89 30 152 1.000
90 30 153 1.000
91 31 92 1.000
92 31 151 1.000
93 32 34 1.000
94 32 43 1.000
95 32 44 1.000
96 32 57 1.000
97 32 91 1.000
98 32 147 1.000
99 32 150 1.000
100 32 152 1.000
101 33 88 1.000
102 33 90 1.000
103 33 148 1.000
104 33 149 1.000
105 34 36 1.000
106 34 43 1.000
107 34 83 1.000
108 34 89 1.000
109 34 91 1.000
110 34 147 1.000
111 35 88 1.000
112 35 146 1.000
113 36 38 1.000
114 36 59 1.000
115 36 84 1.000
116 36 143 1.000
117 38 39 1.000
118 38 40 1.000
119 38 143 1.000
120 38 144 1.000
121 39 40 1.000
122 39 82 1.000
123 39 84 1.000
124 40 60 1.000
125 40 139 1.000
126 40 140 1.000
127 42 45 1.000
128 42 56 1.000
129 42 128 1.000
130 42 139 1.000
131 42 141 1.000
132 43 44 1.000
133 43 57 1.000
134 43 59 1.000
135 43 143 1.000
136 43 147 1.000
137 44 55 1.000
138 44 57 1.000
139 44 93 1.000
140 44 123 1.000
141 44 125 1.000
142 44 152 1.000
143 45 47 1.000
144 45 50 1.000
145 45 54 1.000
146 45 56 1.000
147 45 122 1.000
148 45 124 1.000
149 45 128 1.000
150 45 129 1.000
151 45 130 1.000
152 47 50 1.000
153 47 54 1.000
154 47 122 1.000
155 47 129 1.000
156 48 49 1.000
157 48 53 1.000
158 48 118 1.000
159 48 121 1.000
160 49 50 1.000
161 49 51 1.000
162 49 52 1.000
163 49 53 1.000
164 50 122 1.000
165 50 130 1.000
166 51 52 1.000
167 52 53 1.000
168 53 70 1.000
169 53 118 1.000
170 54 56 1.000
171 54 67 1.000
172 54 69 1.000
173 54 130 1.000
174 54 135 1.000
175 54 136 1.000
176 55 57 1.000
177 55 66 1.000
178 55 68 1.000
179 55 93 1.000
180 55 100 1.000
181 56 65 1.000
182 56 67 1.000
183 56 128 1.000
184 56 135 1.000
185 56 139 1.000
186 57 64 1.000
187 57 66 1.000
188 57 91 1.000
189 57 93 1.000
190 57 102 1.000
191 59 64 1.000
192 59 83 1.000
193 59 84 1.000
194 59 143 1.000
195 60 61 1.000
196 60 65 1.000
197 60 67 1.000
198 60 137 1.000
199 60 139 1.000
200 61 82 1.000
201 63 64 1.000
202 63 81 1.000
203 63 82 1.000
204 64 83 1.000
205 64 102 1.000
206 64 104 1.000
207 65 67 1.000
208 65 76 1.000
209 65 137 1.000
210 65 139 1.000
211 66 68 1.000
212 66 75 1.000
213 66 100 1.000
214 66 102 1.000
215 66 110 1.000
216 66 112 1.000
217 67 76 1.000
218 67 135 1.000
219 67 136 1.000
220 67 137 1.000
221 67 139 1.000
222 68 70 1.000
223 68 73 1.000
224 68 75 1.000
225 68 100 1.000
226 68 112 1.000
227 68 115 1.000
228 69 74 1.000
229 69 136 1.000
230 70 71 1.000
231 70 72 1.000
232 70 73 1.000
233 70 116 1.000
234 71 72 1.000
235 72 73 1.000
236 73 75 1.000
237 73 115 1.000
238 74 136 1.000
239 75 77 1.000
240 75 112 1.000
241 75 115 1.000
242 75 136 1.000
243 76 136 1.000
244 76 137 1.000
245 77 79 1.000
246 77 110 1.000
247 77 112 1.000
248 79 109 1.000
249 79 110 1.000
250 81 83 1.000
251 81 104 1.000
252 81 107 1.000
253 81 109 1.000
254 82 84 1.000
255 83 89 1.000
256 83 91 1.000
257 83 104 1.000
258 85 87 1.000
259 85 89 1.000
260 87 89 1.000
261 87 105 1.000
262 88 146 1.000
263 88 148 1.000
264 89 91 1.000
265 89 104 1.000
266 89 105 1.000
267 90 92 1.000
268 90 105 1.000
269 90 149 1.000
270 91 93 1.000
271 91 102 1.000
272 91 104 1.000
273 92 94 1.000
274 92 103 1.000
275 93 100 1.000
276 93 102 1.000
277 94 101 1.000
278 94 103 1.000
279 95 100 1.000
280 95 116 1.000
281 96 99 1.000
282 96 101 1.000
283 96 111 1.000
284 98 99 1.000
285 98 113 1.000
286 98 114 1.000
287 99 101 1.000
288 99 111 1.000
289 99 113 1.000
290 100 112 1.000
291 100 115 1.000
292 101 103 1.000
293 101 108 1.000
294 101 111 1.000
295 102 104 1.000
296 102 109 1.000
297 102 110 1.000
298 103 108 1.000
299 104 105 1.000
300 104 109 1.000
301 107 109 1.000
302 108 111 1.000
303 109 110 1.000
304 110 112 1.000
305 111 113 1.000
306 112 115 1.000
307 113 114 1.000
308 115 116 1.000
309 118 119 1.000
310 119 120 1.000
311 120 122 1.000
312 120 159 1.000
313 121 123 1.000
314 121 153 1.000
315 122 129 1.000
316 123 125 1.000
317 123 152 1.000
318 123 153 1.000
319 124 129 1.000
320 125 147 1.000
321 125 150 1.000
322 125 152 1.000
323 128 130 1.000
324 128 132 1.000
325 128 135 1.000
326 128 141 1.000
327 130 131 1.000
328 130 134 1.000
329 130 135 1.000
330 131 133 1.000
331 131 134 1.000
332 132 135 1.000
333 132 141 1.000
334 133 134 1.000
335 135 138 1.000
336 135 139 1.000
337 136 137 1.000
338 137 138 1.000
339 139 141 1.000
340 140 141 1.000
341 140 142 1.000
342 146 170 1.000
343 147 150 1.000
344 147 152 1.000
345 148 149 1.000
346 150 152 1.000
347 153 154 1.000
348 154 156 1.000
349 154 157 1.000
350 155 158 1.000
351 158 161 1.000
352 159 160 1.000
353 163 164 1.000
354 163 167 1.000
355 164 165 1.000