ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1od3A_ALL_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 9922 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: MGSSHHHHHHSSGLVPRGSHMASTPANVNSGPTSPVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSKSGT
3 #PDB: 1od3
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: ALL
8 #CUTOFF: 5.0
9 36 37 1.000
10 36 38 1.000
11 37 38 1.000
12 37 39 1.000
13 38 39 1.000
14 38 40 1.000
15 39 40 1.000
16 39 41 1.000
17 39 84 1.000
18 39 85 1.000
19 39 86 1.000
20 39 145 1.000
21 40 41 1.000
22 40 42 1.000
23 40 46 1.000
24 40 50 1.000
25 40 52 1.000
26 40 82 1.000
27 40 83 1.000
28 40 84 1.000
29 40 85 1.000
30 40 86 1.000
31 41 42 1.000
32 41 43 1.000
33 41 44 1.000
34 41 46 1.000
35 41 85 1.000
36 41 86 1.000
37 42 43 1.000
38 42 44 1.000
39 42 46 1.000
40 42 85 1.000
41 42 86 1.000
42 42 87 1.000
43 42 162 1.000
44 42 163 1.000
45 43 44 1.000
46 43 45 1.000
47 43 86 1.000
48 43 87 1.000
49 43 88 1.000
50 43 90 1.000
51 43 91 1.000
52 43 162 1.000
53 43 163 1.000
54 43 164 1.000
55 43 165 1.000
56 44 45 1.000
57 44 46 1.000
58 44 161 1.000
59 44 162 1.000
60 45 46 1.000
61 45 47 1.000
62 45 160 1.000
63 45 161 1.000
64 45 162 1.000
65 46 47 1.000
66 46 48 1.000
67 46 82 1.000
68 46 85 1.000
69 46 159 1.000
70 46 160 1.000
71 46 161 1.000
72 46 162 1.000
73 46 163 1.000
74 47 48 1.000
75 47 49 1.000
76 47 50 1.000
77 47 51 1.000
78 47 69 1.000
79 47 82 1.000
80 47 159 1.000
81 47 160 1.000
82 47 161 1.000
83 48 49 1.000
84 48 50 1.000
85 48 51 1.000
86 48 71 1.000
87 48 80 1.000
88 48 82 1.000
89 48 158 1.000
90 48 159 1.000
91 48 160 1.000
92 48 161 1.000
93 49 50 1.000
94 49 51 1.000
95 49 61 1.000
96 49 69 1.000
97 49 70 1.000
98 49 71 1.000
99 49 82 1.000
100 49 159 1.000
101 50 51 1.000
102 50 52 1.000
103 50 82 1.000
104 51 52 1.000
105 51 53 1.000
106 51 54 1.000
107 51 59 1.000
108 51 61 1.000
109 51 71 1.000
110 51 80 1.000
111 51 81 1.000
112 51 82 1.000
113 52 53 1.000
114 52 54 1.000
115 52 81 1.000
116 52 82 1.000
117 52 83 1.000
118 53 54 1.000
119 53 55 1.000
120 53 79 1.000
121 53 80 1.000
122 53 81 1.000
123 54 55 1.000
124 54 56 1.000
125 54 79 1.000
126 54 80 1.000
127 54 81 1.000
128 55 56 1.000
129 55 57 1.000
130 55 59 1.000
131 55 77 1.000
132 55 78 1.000
133 55 79 1.000
134 55 80 1.000
135 56 57 1.000
136 56 58 1.000
137 56 59 1.000
138 56 78 1.000
139 56 79 1.000
140 57 58 1.000
141 57 59 1.000
142 57 78 1.000
143 58 59 1.000
144 58 60 1.000
145 58 72 1.000
146 58 73 1.000
147 58 75 1.000
148 58 78 1.000
149 59 60 1.000
150 59 61 1.000
151 59 71 1.000
152 59 72 1.000
153 59 73 1.000
154 59 74 1.000
155 59 78 1.000
156 59 79 1.000
157 59 80 1.000
158 60 61 1.000
159 60 62 1.000
160 60 70 1.000
161 60 71 1.000
162 60 72 1.000
163 60 73 1.000
164 61 62 1.000
165 61 63 1.000
166 61 69 1.000
167 61 70 1.000
168 61 71 1.000
169 62 63 1.000
170 62 64 1.000
171 62 68 1.000
172 62 69 1.000
173 62 70 1.000
174 62 71 1.000
175 62 72 1.000
176 62 73 1.000
177 62 132 1.000
178 62 157 1.000
179 63 64 1.000
180 63 65 1.000
181 63 68 1.000
182 63 69 1.000
183 64 65 1.000
184 64 66 1.000
185 64 67 1.000
186 64 68 1.000
187 64 69 1.000
188 64 70 1.000
189 64 132 1.000
190 64 159 1.000
191 65 66 1.000
192 65 67 1.000
193 66 67 1.000
194 66 68 1.000
195 67 68 1.000
196 67 69 1.000
197 68 69 1.000
198 68 70 1.000
199 69 70 1.000
200 69 71 1.000
201 69 158 1.000
202 69 159 1.000
203 70 71 1.000
204 70 72 1.000
205 70 132 1.000
206 70 157 1.000
207 70 158 1.000
208 70 159 1.000
209 71 72 1.000
210 71 73 1.000
211 71 74 1.000
212 71 80 1.000
213 71 82 1.000
214 71 152 1.000
215 71 156 1.000
216 71 157 1.000
217 71 158 1.000
218 72 73 1.000
219 72 74 1.000
220 72 156 1.000
221 72 157 1.000
222 73 74 1.000
223 73 75 1.000
224 73 78 1.000
225 73 156 1.000
226 73 157 1.000
227 74 75 1.000
228 74 76 1.000
229 74 78 1.000
230 74 152 1.000
231 74 154 1.000
232 74 155 1.000
233 74 156 1.000
234 74 158 1.000
235 75 76 1.000
236 75 77 1.000
237 75 78 1.000
238 75 152 1.000
239 75 153 1.000
240 75 154 1.000
241 75 155 1.000
242 76 77 1.000
243 76 78 1.000
244 76 152 1.000
245 76 153 1.000
246 76 154 1.000
247 77 78 1.000
248 77 79 1.000
249 77 151 1.000
250 77 152 1.000
251 77 153 1.000
252 78 79 1.000
253 78 80 1.000
254 78 150 1.000
255 78 151 1.000
256 78 152 1.000
257 79 80 1.000
258 79 81 1.000
259 79 113 1.000
260 79 149 1.000
261 79 150 1.000
262 79 151 1.000
263 79 152 1.000
264 80 81 1.000
265 80 82 1.000
266 80 148 1.000
267 80 149 1.000
268 80 150 1.000
269 80 152 1.000
270 81 82 1.000
271 81 83 1.000
272 81 111 1.000
273 81 113 1.000
274 81 147 1.000
275 81 148 1.000
276 81 149 1.000
277 82 83 1.000
278 82 84 1.000
279 82 85 1.000
280 82 146 1.000
281 82 147 1.000
282 82 148 1.000
283 82 149 1.000
284 82 150 1.000
285 82 161 1.000
286 83 84 1.000
287 83 85 1.000
288 83 146 1.000
289 83 147 1.000
290 84 85 1.000
291 84 86 1.000
292 84 145 1.000
293 84 146 1.000
294 84 147 1.000
295 85 86 1.000
296 85 87 1.000
297 85 144 1.000
298 85 145 1.000
299 85 146 1.000
300 85 147 1.000
301 85 148 1.000
302 85 163 1.000
303 86 87 1.000
304 86 88 1.000
305 86 144 1.000
306 86 145 1.000
307 87 88 1.000
308 87 89 1.000
309 87 90 1.000
310 87 91 1.000
311 87 139 1.000
312 87 142 1.000
313 87 143 1.000
314 87 144 1.000
315 87 145 1.000
316 87 146 1.000
317 87 148 1.000
318 87 163 1.000
319 88 89 1.000
320 88 90 1.000
321 88 143 1.000
322 88 144 1.000
323 89 90 1.000
324 89 91 1.000
325 89 141 1.000
326 89 142 1.000
327 89 143 1.000
328 89 144 1.000
329 89 165 1.000
330 90 91 1.000
331 90 92 1.000
332 90 141 1.000
333 90 142 1.000
334 90 143 1.000
335 90 165 1.000
336 91 92 1.000
337 91 93 1.000
338 91 139 1.000
339 91 140 1.000
340 91 141 1.000
341 91 142 1.000
342 91 163 1.000
343 91 164 1.000
344 91 165 1.000
345 92 93 1.000
346 92 94 1.000
347 92 137 1.000
348 92 138 1.000
349 92 139 1.000
350 92 140 1.000
351 92 141 1.000
352 92 164 1.000
353 92 165 1.000
354 92 166 1.000
355 93 94 1.000
356 93 95 1.000
357 93 136 1.000
358 93 137 1.000
359 93 138 1.000
360 93 139 1.000
361 93 162 1.000
362 93 163 1.000
363 93 164 1.000
364 93 165 1.000
365 93 166 1.000
366 94 95 1.000
367 94 96 1.000
368 94 108 1.000
369 94 121 1.000
370 94 135 1.000
371 94 136 1.000
372 94 137 1.000
373 94 139 1.000
374 94 161 1.000
375 94 162 1.000
376 94 163 1.000
377 94 164 1.000
378 95 96 1.000
379 95 97 1.000
380 95 134 1.000
381 95 135 1.000
382 95 136 1.000
383 95 160 1.000
384 95 161 1.000
385 95 162 1.000
386 96 97 1.000
387 96 98 1.000
388 96 121 1.000
389 96 133 1.000
390 96 134 1.000
391 96 135 1.000
392 96 158 1.000
393 96 160 1.000
394 96 161 1.000
395 97 98 1.000
396 97 99 1.000
397 97 132 1.000
398 97 133 1.000
399 97 134 1.000
400 97 157 1.000
401 97 158 1.000
402 97 159 1.000
403 97 160 1.000
404 97 161 1.000
405 98 99 1.000
406 98 100 1.000
407 98 106 1.000
408 98 123 1.000
409 98 126 1.000
410 98 131 1.000
411 98 132 1.000
412 98 133 1.000
413 98 135 1.000
414 98 156 1.000
415 98 157 1.000
416 98 158 1.000
417 98 159 1.000
418 99 100 1.000
419 99 101 1.000
420 99 126 1.000
421 99 128 1.000
422 99 129 1.000
423 99 130 1.000
424 99 131 1.000
425 99 132 1.000
426 99 156 1.000
427 99 157 1.000
428 100 101 1.000
429 100 102 1.000
430 100 104 1.000
431 100 123 1.000
432 100 124 1.000
433 100 125 1.000
434 100 126 1.000
435 100 127 1.000
436 100 128 1.000
437 100 129 1.000
438 100 131 1.000
439 100 155 1.000
440 100 156 1.000
441 101 102 1.000
442 101 103 1.000
443 101 125 1.000
444 101 126 1.000
445 101 127 1.000
446 101 128 1.000
447 101 129 1.000
448 102 103 1.000
449 102 104 1.000
450 102 123 1.000
451 102 124 1.000
452 102 125 1.000
453 102 155 1.000
454 103 104 1.000
455 103 105 1.000
456 103 123 1.000
457 103 124 1.000
458 103 125 1.000
459 104 105 1.000
460 104 106 1.000
461 104 121 1.000
462 104 122 1.000
463 104 123 1.000
464 104 124 1.000
465 104 153 1.000
466 104 154 1.000
467 104 155 1.000
468 104 156 1.000
469 105 106 1.000
470 105 107 1.000
471 105 120 1.000
472 105 121 1.000
473 105 122 1.000
474 105 123 1.000
475 105 151 1.000
476 105 152 1.000
477 105 153 1.000
478 105 154 1.000
479 106 107 1.000
480 106 108 1.000
481 106 119 1.000
482 106 120 1.000
483 106 121 1.000
484 106 123 1.000
485 106 150 1.000
486 106 151 1.000
487 106 152 1.000
488 106 156 1.000
489 106 158 1.000
490 107 108 1.000
491 107 109 1.000
492 107 117 1.000
493 107 119 1.000
494 107 120 1.000
495 107 121 1.000
496 107 149 1.000
497 107 150 1.000
498 107 151 1.000
499 108 109 1.000
500 108 110 1.000
501 108 116 1.000
502 108 117 1.000
503 108 118 1.000
504 108 119 1.000
505 108 120 1.000
506 108 121 1.000
507 108 139 1.000
508 108 148 1.000
509 108 149 1.000
510 108 150 1.000
511 108 163 1.000
512 109 110 1.000
513 109 111 1.000
514 109 112 1.000
515 109 113 1.000
516 109 114 1.000
517 109 115 1.000
518 109 116 1.000
519 109 117 1.000
520 109 118 1.000
521 109 147 1.000
522 109 148 1.000
523 109 149 1.000
524 109 151 1.000
525 110 111 1.000
526 110 112 1.000
527 110 115 1.000
528 110 116 1.000
529 110 118 1.000
530 110 146 1.000
531 110 147 1.000
532 110 148 1.000
533 110 149 1.000
534 111 112 1.000
535 111 113 1.000
536 111 147 1.000
537 111 148 1.000
538 111 149 1.000
539 112 113 1.000
540 112 114 1.000
541 112 115 1.000
542 112 149 1.000
543 113 114 1.000
544 113 115 1.000
545 113 149 1.000
546 113 151 1.000
547 114 115 1.000
548 114 116 1.000
549 115 116 1.000
550 115 117 1.000
551 116 117 1.000
552 116 118 1.000
553 117 118 1.000
554 117 119 1.000
555 117 120 1.000
556 117 140 1.000
557 118 119 1.000
558 118 120 1.000
559 118 138 1.000
560 118 139 1.000
561 118 140 1.000
562 118 142 1.000
563 118 148 1.000
564 119 120 1.000
565 119 121 1.000
566 119 138 1.000
567 119 139 1.000
568 120 121 1.000
569 120 122 1.000
570 120 137 1.000
571 120 138 1.000
572 121 122 1.000
573 121 123 1.000
574 121 135 1.000
575 121 136 1.000
576 121 137 1.000
577 122 123 1.000
578 122 124 1.000
579 122 135 1.000
580 123 124 1.000
581 123 125 1.000
582 123 135 1.000
583 123 156 1.000
584 124 125 1.000
585 124 126 1.000
586 125 126 1.000
587 125 127 1.000
588 125 128 1.000
589 126 127 1.000
590 126 128 1.000
591 126 129 1.000
592 126 131 1.000
593 126 132 1.000
594 126 133 1.000
595 127 128 1.000
596 127 129 1.000
597 128 129 1.000
598 128 130 1.000
599 128 131 1.000
600 129 130 1.000
601 129 131 1.000
602 129 132 1.000
603 129 155 1.000
604 129 156 1.000
605 129 157 1.000
606 130 131 1.000
607 130 132 1.000
608 131 132 1.000
609 131 133 1.000
610 132 133 1.000
611 132 134 1.000
612 132 157 1.000
613 132 158 1.000
614 132 159 1.000
615 133 134 1.000
616 133 135 1.000
617 134 135 1.000
618 134 136 1.000
619 134 160 1.000
620 135 136 1.000
621 135 137 1.000
622 136 137 1.000
623 136 138 1.000
624 137 138 1.000
625 137 139 1.000
626 138 139 1.000
627 138 140 1.000
628 138 166 1.000
629 139 140 1.000
630 139 141 1.000
631 139 142 1.000
632 139 163 1.000
633 140 141 1.000
634 140 142 1.000
635 141 142 1.000
636 141 143 1.000
637 142 143 1.000
638 142 144 1.000
639 142 146 1.000
640 142 148 1.000
641 143 144 1.000
642 143 145 1.000
643 143 146 1.000
644 144 145 1.000
645 144 146 1.000
646 145 146 1.000
647 145 147 1.000
648 146 147 1.000
649 146 148 1.000
650 147 148 1.000
651 147 149 1.000
652 148 149 1.000
653 148 150 1.000
654 148 161 1.000
655 148 163 1.000
656 149 150 1.000
657 149 151 1.000
658 150 151 1.000
659 150 152 1.000
660 150 158 1.000
661 150 161 1.000
662 151 152 1.000
663 151 153 1.000
664 152 153 1.000
665 152 154 1.000
666 152 156 1.000
667 152 158 1.000
668 153 154 1.000
669 153 155 1.000
670 154 155 1.000
671 154 156 1.000
672 155 156 1.000
673 155 157 1.000
674 156 157 1.000
675 156 158 1.000
676 157 158 1.000
677 157 159 1.000
678 158 159 1.000
679 158 160 1.000
680 159 160 1.000
681 159 161 1.000
682 160 161 1.000
683 160 162 1.000
684 161 162 1.000
685 161 163 1.000
686 162 163 1.000
687 162 164 1.000
688 163 164 1.000
689 163 165 1.000
690 164 165 1.000
691 164 166 1.000
692 165 166 1.000
693 165 167 1.000
694 166 167 1.000