ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1od3A_BB:SC_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (11 years, 2 months ago) by duarte
File size: 9448 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line User Rev File contents
1 duarte 884 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: MGSSHHHHHHSSGLVPRGSHMASTPANVNSGPTSPVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSKSGT
3     #PDB: 1od3
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: BB/SC
8     #CUTOFF: 5.0
9     37 36 1.000
10     38 39 1.000
11     38 40 1.000
12     39 40 1.000
13     40 39 1.000
14     40 41 1.000
15     40 85 1.000
16     40 86 1.000
17     41 40 1.000
18     41 42 1.000
19     41 44 1.000
20     41 46 1.000
21     41 85 1.000
22     41 86 1.000
23     42 41 1.000
24     42 43 1.000
25     42 46 1.000
26     42 85 1.000
27     42 86 1.000
28     42 162 1.000
29     42 163 1.000
30     43 41 1.000
31     43 42 1.000
32     43 44 1.000
33     43 162 1.000
34     44 41 1.000
35     44 43 1.000
36     44 45 1.000
37     44 46 1.000
38     44 162 1.000
39     45 44 1.000
40     45 46 1.000
41     45 47 1.000
42     45 160 1.000
43     45 162 1.000
44     46 45 1.000
45     46 47 1.000
46     46 160 1.000
47     46 161 1.000
48     46 162 1.000
49     47 46 1.000
50     47 48 1.000
51     47 49 1.000
52     47 50 1.000
53     47 82 1.000
54     47 160 1.000
55     47 161 1.000
56     48 47 1.000
57     48 49 1.000
58     48 51 1.000
59     48 71 1.000
60     48 80 1.000
61     48 82 1.000
62     48 160 1.000
63     48 161 1.000
64     49 47 1.000
65     49 48 1.000
66     49 50 1.000
67     49 51 1.000
68     49 61 1.000
69     49 71 1.000
70     49 82 1.000
71     50 40 1.000
72     50 47 1.000
73     50 49 1.000
74     50 51 1.000
75     50 52 1.000
76     50 82 1.000
77     51 50 1.000
78     51 52 1.000
79     51 82 1.000
80     52 51 1.000
81     52 53 1.000
82     53 51 1.000
83     53 52 1.000
84     53 54 1.000
85     53 80 1.000
86     53 81 1.000
87     54 51 1.000
88     54 53 1.000
89     54 55 1.000
90     54 79 1.000
91     54 80 1.000
92     55 54 1.000
93     55 57 1.000
94     55 59 1.000
95     55 78 1.000
96     55 79 1.000
97     56 54 1.000
98     56 55 1.000
99     56 57 1.000
100     56 59 1.000
101     56 78 1.000
102     57 58 1.000
103     57 78 1.000
104     58 57 1.000
105     58 59 1.000
106     58 60 1.000
107     58 73 1.000
108     58 78 1.000
109     59 58 1.000
110     59 60 1.000
111     59 73 1.000
112     59 78 1.000
113     60 59 1.000
114     60 61 1.000
115     60 62 1.000
116     60 71 1.000
117     60 73 1.000
118     61 59 1.000
119     61 60 1.000
120     61 62 1.000
121     61 71 1.000
122     62 61 1.000
123     62 63 1.000
124     62 64 1.000
125     62 69 1.000
126     62 70 1.000
127     63 62 1.000
128     63 64 1.000
129     63 65 1.000
130     63 69 1.000
131     64 62 1.000
132     64 63 1.000
133     64 65 1.000
134     65 64 1.000
135     66 64 1.000
136     66 65 1.000
137     67 64 1.000
138     68 63 1.000
139     68 64 1.000
140     68 69 1.000
141     69 47 1.000
142     69 49 1.000
143     69 64 1.000
144     69 70 1.000
145     69 159 1.000
146     70 49 1.000
147     70 61 1.000
148     70 62 1.000
149     70 64 1.000
150     70 69 1.000
151     70 71 1.000
152     70 132 1.000
153     71 48 1.000
154     71 59 1.000
155     71 62 1.000
156     71 70 1.000
157     71 74 1.000
158     71 157 1.000
159     71 158 1.000
160     72 59 1.000
161     72 60 1.000
162     72 62 1.000
163     72 71 1.000
164     72 73 1.000
165     72 74 1.000
166     72 157 1.000
167     73 58 1.000
168     73 59 1.000
169     73 74 1.000
170     73 75 1.000
171     73 78 1.000
172     73 157 1.000
173     74 73 1.000
174     74 75 1.000
175     74 78 1.000
176     74 155 1.000
177     75 74 1.000
178     75 76 1.000
179     75 78 1.000
180     75 152 1.000
181     76 75 1.000
182     76 78 1.000
183     77 55 1.000
184     77 76 1.000
185     77 78 1.000
186     77 79 1.000
187     77 151 1.000
188     78 55 1.000
189     78 79 1.000
190     78 151 1.000
191     78 152 1.000
192     79 54 1.000
193     79 55 1.000
194     79 59 1.000
195     79 78 1.000
196     79 80 1.000
197     79 149 1.000
198     79 152 1.000
199     80 51 1.000
200     80 54 1.000
201     80 79 1.000
202     80 81 1.000
203     80 82 1.000
204     80 149 1.000
205     80 150 1.000
206     80 152 1.000
207     81 51 1.000
208     81 52 1.000
209     81 53 1.000
210     81 80 1.000
211     81 82 1.000
212     81 149 1.000
213     82 40 1.000
214     82 52 1.000
215     82 81 1.000
216     82 83 1.000
217     82 85 1.000
218     82 147 1.000
219     82 148 1.000
220     83 40 1.000
221     83 52 1.000
222     83 81 1.000
223     83 82 1.000
224     83 84 1.000
225     83 85 1.000
226     83 147 1.000
227     84 39 1.000
228     84 40 1.000
229     84 83 1.000
230     84 85 1.000
231     84 145 1.000
232     84 147 1.000
233     85 39 1.000
234     85 84 1.000
235     85 86 1.000
236     85 87 1.000
237     85 145 1.000
238     85 146 1.000
239     86 39 1.000
240     86 41 1.000
241     86 42 1.000
242     86 43 1.000
243     86 85 1.000
244     86 87 1.000
245     86 145 1.000
246     87 42 1.000
247     87 43 1.000
248     87 85 1.000
249     87 86 1.000
250     87 89 1.000
251     88 43 1.000
252     88 86 1.000
253     88 87 1.000
254     88 89 1.000
255     88 143 1.000
256     89 141 1.000
257     89 143 1.000
258     89 165 1.000
259     90 43 1.000
260     90 87 1.000
261     90 89 1.000
262     90 91 1.000
263     90 141 1.000
264     90 143 1.000
265     90 165 1.000
266     91 43 1.000
267     91 87 1.000
268     91 92 1.000
269     91 139 1.000
270     91 141 1.000
271     91 142 1.000
272     91 165 1.000
273     92 91 1.000
274     92 93 1.000
275     92 138 1.000
276     92 139 1.000
277     92 141 1.000
278     92 166 1.000
279     93 91 1.000
280     93 92 1.000
281     93 94 1.000
282     93 139 1.000
283     93 163 1.000
284     93 164 1.000
285     93 166 1.000
286     94 93 1.000
287     94 95 1.000
288     94 136 1.000
289     94 137 1.000
290     94 139 1.000
291     94 163 1.000
292     95 94 1.000
293     95 96 1.000
294     95 136 1.000
295     95 160 1.000
296     95 161 1.000
297     95 162 1.000
298     96 94 1.000
299     96 95 1.000
300     96 97 1.000
301     96 98 1.000
302     96 121 1.000
303     96 134 1.000
304     96 135 1.000
305     96 160 1.000
306     96 161 1.000
307     97 96 1.000
308     97 98 1.000
309     97 132 1.000
310     97 134 1.000
311     97 158 1.000
312     97 159 1.000
313     97 160 1.000
314     98 97 1.000
315     98 99 1.000
316     98 126 1.000
317     98 132 1.000
318     98 133 1.000
319     98 156 1.000
320     99 98 1.000
321     99 100 1.000
322     99 126 1.000
323     99 129 1.000
324     99 132 1.000
325     99 156 1.000
326     99 157 1.000
327     100 99 1.000
328     100 101 1.000
329     100 125 1.000
330     100 126 1.000
331     100 129 1.000
332     101 100 1.000
333     101 102 1.000
334     101 125 1.000
335     101 129 1.000
336     102 100 1.000
337     102 101 1.000
338     102 103 1.000
339     102 104 1.000
340     102 125 1.000
341     103 102 1.000
342     103 104 1.000
343     104 103 1.000
344     104 105 1.000
345     104 122 1.000
346     104 123 1.000
347     104 153 1.000
348     105 104 1.000
349     105 106 1.000
350     105 120 1.000
351     105 152 1.000
352     105 153 1.000
353     106 105 1.000
354     106 107 1.000
355     106 108 1.000
356     106 120 1.000
357     106 121 1.000
358     106 123 1.000
359     106 152 1.000
360     107 106 1.000
361     107 108 1.000
362     107 109 1.000
363     107 117 1.000
364     107 120 1.000
365     107 150 1.000
366     107 151 1.000
367     108 107 1.000
368     108 109 1.000
369     108 117 1.000
370     108 118 1.000
371     108 150 1.000
372     109 108 1.000
373     109 110 1.000
374     109 118 1.000
375     109 148 1.000
376     109 149 1.000
377     110 109 1.000
378     110 112 1.000
379     110 116 1.000
380     110 118 1.000
381     110 149 1.000
382     111 81 1.000
383     111 110 1.000
384     111 112 1.000
385     111 147 1.000
386     111 149 1.000
387     112 109 1.000
388     112 113 1.000
389     112 149 1.000
390     113 109 1.000
391     113 112 1.000
392     113 114 1.000
393     113 149 1.000
394     113 151 1.000
395     114 109 1.000
396     114 112 1.000
397     114 113 1.000
398     115 109 1.000
399     115 112 1.000
400     115 114 1.000
401     115 116 1.000
402     115 117 1.000
403     116 109 1.000
404     116 110 1.000
405     116 117 1.000
406     116 118 1.000
407     117 109 1.000
408     117 116 1.000
409     117 118 1.000
410     117 140 1.000
411     118 116 1.000
412     118 117 1.000
413     118 139 1.000
414     118 140 1.000
415     119 107 1.000
416     119 108 1.000
417     119 117 1.000
418     119 118 1.000
419     119 120 1.000
420     119 139 1.000
421     120 121 1.000
422     120 122 1.000
423     120 137 1.000
424     121 105 1.000
425     121 106 1.000
426     121 120 1.000
427     121 122 1.000
428     121 123 1.000
429     121 137 1.000
430     122 105 1.000
431     122 120 1.000
432     122 121 1.000
433     122 123 1.000
434     122 135 1.000
435     123 100 1.000
436     123 103 1.000
437     123 104 1.000
438     123 121 1.000
439     123 122 1.000
440     123 135 1.000
441     124 100 1.000
442     124 103 1.000
443     124 123 1.000
444     124 125 1.000
445     124 126 1.000
446     125 100 1.000
447     125 126 1.000
448     126 100 1.000
449     126 125 1.000
450     126 128 1.000
451     126 131 1.000
452     126 133 1.000
453     127 101 1.000
454     127 125 1.000
455     127 126 1.000
456     127 128 1.000
457     128 99 1.000
458     128 101 1.000
459     128 125 1.000
460     128 126 1.000
461     128 129 1.000
462     128 131 1.000
463     129 99 1.000
464     129 101 1.000
465     129 126 1.000
466     129 128 1.000
467     129 130 1.000
468     129 132 1.000
469     129 157 1.000
470     130 99 1.000
471     130 128 1.000
472     130 129 1.000
473     130 131 1.000
474     130 132 1.000
475     131 99 1.000
476     131 126 1.000
477     131 128 1.000
478     131 130 1.000
479     131 132 1.000
480     131 133 1.000
481     132 97 1.000
482     132 99 1.000
483     132 126 1.000
484     132 131 1.000
485     132 133 1.000
486     133 97 1.000
487     133 98 1.000
488     133 126 1.000
489     133 132 1.000
490     133 134 1.000
491     133 135 1.000
492     134 95 1.000
493     134 97 1.000
494     134 133 1.000
495     134 135 1.000
496     135 95 1.000
497     135 96 1.000
498     135 98 1.000
499     135 121 1.000
500     135 134 1.000
501     135 136 1.000
502     136 95 1.000
503     136 121 1.000
504     136 135 1.000
505     136 137 1.000
506     137 93 1.000
507     137 94 1.000
508     137 136 1.000
509     137 138 1.000
510     137 139 1.000
511     138 93 1.000
512     138 137 1.000
513     138 139 1.000
514     139 92 1.000
515     139 138 1.000
516     139 140 1.000
517     140 92 1.000
518     140 118 1.000
519     140 139 1.000
520     140 141 1.000
521     140 142 1.000
522     141 92 1.000
523     141 140 1.000
524     141 142 1.000
525     142 87 1.000
526     142 91 1.000
527     142 139 1.000
528     142 141 1.000
529     142 143 1.000
530     143 87 1.000
531     143 142 1.000
532     143 146 1.000
533     144 86 1.000
534     144 87 1.000
535     144 143 1.000
536     144 145 1.000
537     144 146 1.000
538     145 86 1.000
539     145 146 1.000
540     146 85 1.000
541     146 87 1.000
542     146 110 1.000
543     146 145 1.000
544     146 147 1.000
545     146 148 1.000
546     147 110 1.000
547     147 146 1.000
548     147 148 1.000
549     147 149 1.000
550     148 81 1.000
551     148 82 1.000
552     148 85 1.000
553     148 147 1.000
554     148 149 1.000
555     149 81 1.000
556     149 108 1.000
557     149 109 1.000
558     149 148 1.000
559     149 150 1.000
560     149 151 1.000
561     150 79 1.000
562     150 80 1.000
563     150 82 1.000
564     150 106 1.000
565     150 149 1.000
566     150 151 1.000
567     150 152 1.000
568     151 79 1.000
569     151 106 1.000
570     151 107 1.000
571     151 149 1.000
572     151 150 1.000
573     151 152 1.000
574     152 74 1.000
575     152 76 1.000
576     152 151 1.000
577     152 153 1.000
578     153 76 1.000
579     153 104 1.000
580     153 105 1.000
581     153 152 1.000
582     154 74 1.000
583     154 76 1.000
584     154 104 1.000
585     154 152 1.000
586     154 153 1.000
587     154 155 1.000
588     154 156 1.000
589     155 74 1.000
590     155 100 1.000
591     155 104 1.000
592     155 129 1.000
593     155 156 1.000
594     156 74 1.000
595     156 100 1.000
596     156 104 1.000
597     156 129 1.000
598     156 155 1.000
599     156 157 1.000
600     156 158 1.000
601     157 98 1.000
602     157 99 1.000
603     157 129 1.000
604     157 132 1.000
605     157 156 1.000
606     157 158 1.000
607     158 48 1.000
608     158 70 1.000
609     158 71 1.000
610     158 98 1.000
611     158 132 1.000
612     158 157 1.000
613     158 159 1.000
614     159 47 1.000
615     159 48 1.000
616     159 49 1.000
617     159 64 1.000
618     159 70 1.000
619     159 132 1.000
620     159 158 1.000
621     159 160 1.000
622     160 47 1.000
623     160 48 1.000
624     160 96 1.000
625     160 97 1.000
626     160 158 1.000
627     160 159 1.000
628     160 161 1.000
629     161 45 1.000
630     161 46 1.000
631     161 96 1.000
632     161 160 1.000
633     161 162 1.000
634     162 45 1.000
635     162 94 1.000
636     162 95 1.000
637     162 160 1.000
638     162 161 1.000
639     162 163 1.000
640     163 43 1.000
641     163 91 1.000
642     163 162 1.000
643     163 164 1.000
644     164 43 1.000
645     164 91 1.000
646     164 92 1.000
647     164 93 1.000
648     164 163 1.000
649     164 165 1.000
650     165 43 1.000
651     165 91 1.000
652     165 92 1.000
653     165 93 1.000
654     165 164 1.000
655     165 166 1.000
656     166 92 1.000
657     166 93 1.000
658     166 164 1.000
659     166 165 1.000
660     167 165 1.000
661     167 166 1.000