ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1od3A_BB:SC_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 9448 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: MGSSHHHHHHSSGLVPRGSHMASTPANVNSGPTSPVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSKSGT
3 #PDB: 1od3
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: BB/SC
8 #CUTOFF: 5.0
9 37 36 1.000
10 38 39 1.000
11 38 40 1.000
12 39 40 1.000
13 40 39 1.000
14 40 41 1.000
15 40 85 1.000
16 40 86 1.000
17 41 40 1.000
18 41 42 1.000
19 41 44 1.000
20 41 46 1.000
21 41 85 1.000
22 41 86 1.000
23 42 41 1.000
24 42 43 1.000
25 42 46 1.000
26 42 85 1.000
27 42 86 1.000
28 42 162 1.000
29 42 163 1.000
30 43 41 1.000
31 43 42 1.000
32 43 44 1.000
33 43 162 1.000
34 44 41 1.000
35 44 43 1.000
36 44 45 1.000
37 44 46 1.000
38 44 162 1.000
39 45 44 1.000
40 45 46 1.000
41 45 47 1.000
42 45 160 1.000
43 45 162 1.000
44 46 45 1.000
45 46 47 1.000
46 46 160 1.000
47 46 161 1.000
48 46 162 1.000
49 47 46 1.000
50 47 48 1.000
51 47 49 1.000
52 47 50 1.000
53 47 82 1.000
54 47 160 1.000
55 47 161 1.000
56 48 47 1.000
57 48 49 1.000
58 48 51 1.000
59 48 71 1.000
60 48 80 1.000
61 48 82 1.000
62 48 160 1.000
63 48 161 1.000
64 49 47 1.000
65 49 48 1.000
66 49 50 1.000
67 49 51 1.000
68 49 61 1.000
69 49 71 1.000
70 49 82 1.000
71 50 40 1.000
72 50 47 1.000
73 50 49 1.000
74 50 51 1.000
75 50 52 1.000
76 50 82 1.000
77 51 50 1.000
78 51 52 1.000
79 51 82 1.000
80 52 51 1.000
81 52 53 1.000
82 53 51 1.000
83 53 52 1.000
84 53 54 1.000
85 53 80 1.000
86 53 81 1.000
87 54 51 1.000
88 54 53 1.000
89 54 55 1.000
90 54 79 1.000
91 54 80 1.000
92 55 54 1.000
93 55 57 1.000
94 55 59 1.000
95 55 78 1.000
96 55 79 1.000
97 56 54 1.000
98 56 55 1.000
99 56 57 1.000
100 56 59 1.000
101 56 78 1.000
102 57 58 1.000
103 57 78 1.000
104 58 57 1.000
105 58 59 1.000
106 58 60 1.000
107 58 73 1.000
108 58 78 1.000
109 59 58 1.000
110 59 60 1.000
111 59 73 1.000
112 59 78 1.000
113 60 59 1.000
114 60 61 1.000
115 60 62 1.000
116 60 71 1.000
117 60 73 1.000
118 61 59 1.000
119 61 60 1.000
120 61 62 1.000
121 61 71 1.000
122 62 61 1.000
123 62 63 1.000
124 62 64 1.000
125 62 69 1.000
126 62 70 1.000
127 63 62 1.000
128 63 64 1.000
129 63 65 1.000
130 63 69 1.000
131 64 62 1.000
132 64 63 1.000
133 64 65 1.000
134 65 64 1.000
135 66 64 1.000
136 66 65 1.000
137 67 64 1.000
138 68 63 1.000
139 68 64 1.000
140 68 69 1.000
141 69 47 1.000
142 69 49 1.000
143 69 64 1.000
144 69 70 1.000
145 69 159 1.000
146 70 49 1.000
147 70 61 1.000
148 70 62 1.000
149 70 64 1.000
150 70 69 1.000
151 70 71 1.000
152 70 132 1.000
153 71 48 1.000
154 71 59 1.000
155 71 62 1.000
156 71 70 1.000
157 71 74 1.000
158 71 157 1.000
159 71 158 1.000
160 72 59 1.000
161 72 60 1.000
162 72 62 1.000
163 72 71 1.000
164 72 73 1.000
165 72 74 1.000
166 72 157 1.000
167 73 58 1.000
168 73 59 1.000
169 73 74 1.000
170 73 75 1.000
171 73 78 1.000
172 73 157 1.000
173 74 73 1.000
174 74 75 1.000
175 74 78 1.000
176 74 155 1.000
177 75 74 1.000
178 75 76 1.000
179 75 78 1.000
180 75 152 1.000
181 76 75 1.000
182 76 78 1.000
183 77 55 1.000
184 77 76 1.000
185 77 78 1.000
186 77 79 1.000
187 77 151 1.000
188 78 55 1.000
189 78 79 1.000
190 78 151 1.000
191 78 152 1.000
192 79 54 1.000
193 79 55 1.000
194 79 59 1.000
195 79 78 1.000
196 79 80 1.000
197 79 149 1.000
198 79 152 1.000
199 80 51 1.000
200 80 54 1.000
201 80 79 1.000
202 80 81 1.000
203 80 82 1.000
204 80 149 1.000
205 80 150 1.000
206 80 152 1.000
207 81 51 1.000
208 81 52 1.000
209 81 53 1.000
210 81 80 1.000
211 81 82 1.000
212 81 149 1.000
213 82 40 1.000
214 82 52 1.000
215 82 81 1.000
216 82 83 1.000
217 82 85 1.000
218 82 147 1.000
219 82 148 1.000
220 83 40 1.000
221 83 52 1.000
222 83 81 1.000
223 83 82 1.000
224 83 84 1.000
225 83 85 1.000
226 83 147 1.000
227 84 39 1.000
228 84 40 1.000
229 84 83 1.000
230 84 85 1.000
231 84 145 1.000
232 84 147 1.000
233 85 39 1.000
234 85 84 1.000
235 85 86 1.000
236 85 87 1.000
237 85 145 1.000
238 85 146 1.000
239 86 39 1.000
240 86 41 1.000
241 86 42 1.000
242 86 43 1.000
243 86 85 1.000
244 86 87 1.000
245 86 145 1.000
246 87 42 1.000
247 87 43 1.000
248 87 85 1.000
249 87 86 1.000
250 87 89 1.000
251 88 43 1.000
252 88 86 1.000
253 88 87 1.000
254 88 89 1.000
255 88 143 1.000
256 89 141 1.000
257 89 143 1.000
258 89 165 1.000
259 90 43 1.000
260 90 87 1.000
261 90 89 1.000
262 90 91 1.000
263 90 141 1.000
264 90 143 1.000
265 90 165 1.000
266 91 43 1.000
267 91 87 1.000
268 91 92 1.000
269 91 139 1.000
270 91 141 1.000
271 91 142 1.000
272 91 165 1.000
273 92 91 1.000
274 92 93 1.000
275 92 138 1.000
276 92 139 1.000
277 92 141 1.000
278 92 166 1.000
279 93 91 1.000
280 93 92 1.000
281 93 94 1.000
282 93 139 1.000
283 93 163 1.000
284 93 164 1.000
285 93 166 1.000
286 94 93 1.000
287 94 95 1.000
288 94 136 1.000
289 94 137 1.000
290 94 139 1.000
291 94 163 1.000
292 95 94 1.000
293 95 96 1.000
294 95 136 1.000
295 95 160 1.000
296 95 161 1.000
297 95 162 1.000
298 96 94 1.000
299 96 95 1.000
300 96 97 1.000
301 96 98 1.000
302 96 121 1.000
303 96 134 1.000
304 96 135 1.000
305 96 160 1.000
306 96 161 1.000
307 97 96 1.000
308 97 98 1.000
309 97 132 1.000
310 97 134 1.000
311 97 158 1.000
312 97 159 1.000
313 97 160 1.000
314 98 97 1.000
315 98 99 1.000
316 98 126 1.000
317 98 132 1.000
318 98 133 1.000
319 98 156 1.000
320 99 98 1.000
321 99 100 1.000
322 99 126 1.000
323 99 129 1.000
324 99 132 1.000
325 99 156 1.000
326 99 157 1.000
327 100 99 1.000
328 100 101 1.000
329 100 125 1.000
330 100 126 1.000
331 100 129 1.000
332 101 100 1.000
333 101 102 1.000
334 101 125 1.000
335 101 129 1.000
336 102 100 1.000
337 102 101 1.000
338 102 103 1.000
339 102 104 1.000
340 102 125 1.000
341 103 102 1.000
342 103 104 1.000
343 104 103 1.000
344 104 105 1.000
345 104 122 1.000
346 104 123 1.000
347 104 153 1.000
348 105 104 1.000
349 105 106 1.000
350 105 120 1.000
351 105 152 1.000
352 105 153 1.000
353 106 105 1.000
354 106 107 1.000
355 106 108 1.000
356 106 120 1.000
357 106 121 1.000
358 106 123 1.000
359 106 152 1.000
360 107 106 1.000
361 107 108 1.000
362 107 109 1.000
363 107 117 1.000
364 107 120 1.000
365 107 150 1.000
366 107 151 1.000
367 108 107 1.000
368 108 109 1.000
369 108 117 1.000
370 108 118 1.000
371 108 150 1.000
372 109 108 1.000
373 109 110 1.000
374 109 118 1.000
375 109 148 1.000
376 109 149 1.000
377 110 109 1.000
378 110 112 1.000
379 110 116 1.000
380 110 118 1.000
381 110 149 1.000
382 111 81 1.000
383 111 110 1.000
384 111 112 1.000
385 111 147 1.000
386 111 149 1.000
387 112 109 1.000
388 112 113 1.000
389 112 149 1.000
390 113 109 1.000
391 113 112 1.000
392 113 114 1.000
393 113 149 1.000
394 113 151 1.000
395 114 109 1.000
396 114 112 1.000
397 114 113 1.000
398 115 109 1.000
399 115 112 1.000
400 115 114 1.000
401 115 116 1.000
402 115 117 1.000
403 116 109 1.000
404 116 110 1.000
405 116 117 1.000
406 116 118 1.000
407 117 109 1.000
408 117 116 1.000
409 117 118 1.000
410 117 140 1.000
411 118 116 1.000
412 118 117 1.000
413 118 139 1.000
414 118 140 1.000
415 119 107 1.000
416 119 108 1.000
417 119 117 1.000
418 119 118 1.000
419 119 120 1.000
420 119 139 1.000
421 120 121 1.000
422 120 122 1.000
423 120 137 1.000
424 121 105 1.000
425 121 106 1.000
426 121 120 1.000
427 121 122 1.000
428 121 123 1.000
429 121 137 1.000
430 122 105 1.000
431 122 120 1.000
432 122 121 1.000
433 122 123 1.000
434 122 135 1.000
435 123 100 1.000
436 123 103 1.000
437 123 104 1.000
438 123 121 1.000
439 123 122 1.000
440 123 135 1.000
441 124 100 1.000
442 124 103 1.000
443 124 123 1.000
444 124 125 1.000
445 124 126 1.000
446 125 100 1.000
447 125 126 1.000
448 126 100 1.000
449 126 125 1.000
450 126 128 1.000
451 126 131 1.000
452 126 133 1.000
453 127 101 1.000
454 127 125 1.000
455 127 126 1.000
456 127 128 1.000
457 128 99 1.000
458 128 101 1.000
459 128 125 1.000
460 128 126 1.000
461 128 129 1.000
462 128 131 1.000
463 129 99 1.000
464 129 101 1.000
465 129 126 1.000
466 129 128 1.000
467 129 130 1.000
468 129 132 1.000
469 129 157 1.000
470 130 99 1.000
471 130 128 1.000
472 130 129 1.000
473 130 131 1.000
474 130 132 1.000
475 131 99 1.000
476 131 126 1.000
477 131 128 1.000
478 131 130 1.000
479 131 132 1.000
480 131 133 1.000
481 132 97 1.000
482 132 99 1.000
483 132 126 1.000
484 132 131 1.000
485 132 133 1.000
486 133 97 1.000
487 133 98 1.000
488 133 126 1.000
489 133 132 1.000
490 133 134 1.000
491 133 135 1.000
492 134 95 1.000
493 134 97 1.000
494 134 133 1.000
495 134 135 1.000
496 135 95 1.000
497 135 96 1.000
498 135 98 1.000
499 135 121 1.000
500 135 134 1.000
501 135 136 1.000
502 136 95 1.000
503 136 121 1.000
504 136 135 1.000
505 136 137 1.000
506 137 93 1.000
507 137 94 1.000
508 137 136 1.000
509 137 138 1.000
510 137 139 1.000
511 138 93 1.000
512 138 137 1.000
513 138 139 1.000
514 139 92 1.000
515 139 138 1.000
516 139 140 1.000
517 140 92 1.000
518 140 118 1.000
519 140 139 1.000
520 140 141 1.000
521 140 142 1.000
522 141 92 1.000
523 141 140 1.000
524 141 142 1.000
525 142 87 1.000
526 142 91 1.000
527 142 139 1.000
528 142 141 1.000
529 142 143 1.000
530 143 87 1.000
531 143 142 1.000
532 143 146 1.000
533 144 86 1.000
534 144 87 1.000
535 144 143 1.000
536 144 145 1.000
537 144 146 1.000
538 145 86 1.000
539 145 146 1.000
540 146 85 1.000
541 146 87 1.000
542 146 110 1.000
543 146 145 1.000
544 146 147 1.000
545 146 148 1.000
546 147 110 1.000
547 147 146 1.000
548 147 148 1.000
549 147 149 1.000
550 148 81 1.000
551 148 82 1.000
552 148 85 1.000
553 148 147 1.000
554 148 149 1.000
555 149 81 1.000
556 149 108 1.000
557 149 109 1.000
558 149 148 1.000
559 149 150 1.000
560 149 151 1.000
561 150 79 1.000
562 150 80 1.000
563 150 82 1.000
564 150 106 1.000
565 150 149 1.000
566 150 151 1.000
567 150 152 1.000
568 151 79 1.000
569 151 106 1.000
570 151 107 1.000
571 151 149 1.000
572 151 150 1.000
573 151 152 1.000
574 152 74 1.000
575 152 76 1.000
576 152 151 1.000
577 152 153 1.000
578 153 76 1.000
579 153 104 1.000
580 153 105 1.000
581 153 152 1.000
582 154 74 1.000
583 154 76 1.000
584 154 104 1.000
585 154 152 1.000
586 154 153 1.000
587 154 155 1.000
588 154 156 1.000
589 155 74 1.000
590 155 100 1.000
591 155 104 1.000
592 155 129 1.000
593 155 156 1.000
594 156 74 1.000
595 156 100 1.000
596 156 104 1.000
597 156 129 1.000
598 156 155 1.000
599 156 157 1.000
600 156 158 1.000
601 157 98 1.000
602 157 99 1.000
603 157 129 1.000
604 157 132 1.000
605 157 156 1.000
606 157 158 1.000
607 158 48 1.000
608 158 70 1.000
609 158 71 1.000
610 158 98 1.000
611 158 132 1.000
612 158 157 1.000
613 158 159 1.000
614 159 47 1.000
615 159 48 1.000
616 159 49 1.000
617 159 64 1.000
618 159 70 1.000
619 159 132 1.000
620 159 158 1.000
621 159 160 1.000
622 160 47 1.000
623 160 48 1.000
624 160 96 1.000
625 160 97 1.000
626 160 158 1.000
627 160 159 1.000
628 160 161 1.000
629 161 45 1.000
630 161 46 1.000
631 161 96 1.000
632 161 160 1.000
633 161 162 1.000
634 162 45 1.000
635 162 94 1.000
636 162 95 1.000
637 162 160 1.000
638 162 161 1.000
639 162 163 1.000
640 163 43 1.000
641 163 91 1.000
642 163 162 1.000
643 163 164 1.000
644 164 43 1.000
645 164 91 1.000
646 164 92 1.000
647 164 93 1.000
648 164 163 1.000
649 164 165 1.000
650 165 43 1.000
651 165 91 1.000
652 165 92 1.000
653 165 93 1.000
654 165 164 1.000
655 165 166 1.000
656 166 92 1.000
657 166 93 1.000
658 166 164 1.000
659 166 165 1.000
660 167 165 1.000
661 167 166 1.000