ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1od3A_BB_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 7575 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: MGSSHHHHHHSSGLVPRGSHMASTPANVNSGPTSPVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSKSGT
3 #PDB: 1od3
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: BB
8 #CUTOFF: 5.0
9 36 37 1.000
10 36 38 1.000
11 37 38 1.000
12 37 39 1.000
13 38 39 1.000
14 38 40 1.000
15 39 40 1.000
16 39 41 1.000
17 39 84 1.000
18 40 41 1.000
19 40 42 1.000
20 40 84 1.000
21 40 85 1.000
22 40 86 1.000
23 41 42 1.000
24 41 43 1.000
25 41 44 1.000
26 41 86 1.000
27 42 43 1.000
28 42 44 1.000
29 42 85 1.000
30 42 86 1.000
31 42 87 1.000
32 42 162 1.000
33 42 163 1.000
34 43 44 1.000
35 43 45 1.000
36 43 86 1.000
37 43 163 1.000
38 44 45 1.000
39 44 46 1.000
40 44 161 1.000
41 44 162 1.000
42 45 46 1.000
43 45 47 1.000
44 45 161 1.000
45 45 162 1.000
46 46 47 1.000
47 46 48 1.000
48 46 159 1.000
49 46 160 1.000
50 46 161 1.000
51 46 162 1.000
52 47 48 1.000
53 47 49 1.000
54 47 50 1.000
55 47 51 1.000
56 47 159 1.000
57 47 160 1.000
58 48 49 1.000
59 48 50 1.000
60 48 51 1.000
61 48 158 1.000
62 48 159 1.000
63 48 160 1.000
64 49 50 1.000
65 49 51 1.000
66 49 159 1.000
67 50 51 1.000
68 50 52 1.000
69 51 52 1.000
70 51 53 1.000
71 51 81 1.000
72 51 82 1.000
73 52 53 1.000
74 52 54 1.000
75 52 81 1.000
76 52 82 1.000
77 53 54 1.000
78 53 55 1.000
79 53 79 1.000
80 53 80 1.000
81 53 81 1.000
82 54 55 1.000
83 54 56 1.000
84 54 79 1.000
85 54 80 1.000
86 54 81 1.000
87 55 56 1.000
88 55 57 1.000
89 55 77 1.000
90 55 78 1.000
91 55 79 1.000
92 55 80 1.000
93 56 57 1.000
94 56 58 1.000
95 56 59 1.000
96 56 78 1.000
97 56 79 1.000
98 57 58 1.000
99 57 59 1.000
100 58 59 1.000
101 58 60 1.000
102 58 72 1.000
103 58 73 1.000
104 59 60 1.000
105 59 61 1.000
106 59 72 1.000
107 59 73 1.000
108 60 61 1.000
109 60 62 1.000
110 60 70 1.000
111 60 71 1.000
112 60 72 1.000
113 60 73 1.000
114 61 62 1.000
115 61 63 1.000
116 61 70 1.000
117 61 71 1.000
118 62 63 1.000
119 62 64 1.000
120 62 68 1.000
121 62 69 1.000
122 62 70 1.000
123 63 64 1.000
124 63 65 1.000
125 63 68 1.000
126 63 69 1.000
127 64 65 1.000
128 64 66 1.000
129 64 67 1.000
130 64 68 1.000
131 64 69 1.000
132 65 66 1.000
133 65 67 1.000
134 66 67 1.000
135 66 68 1.000
136 67 68 1.000
137 67 69 1.000
138 68 69 1.000
139 68 70 1.000
140 69 70 1.000
141 69 71 1.000
142 69 158 1.000
143 69 159 1.000
144 70 71 1.000
145 70 72 1.000
146 70 158 1.000
147 70 159 1.000
148 71 72 1.000
149 71 73 1.000
150 71 156 1.000
151 71 157 1.000
152 71 158 1.000
153 72 73 1.000
154 72 74 1.000
155 72 156 1.000
156 72 157 1.000
157 73 74 1.000
158 73 75 1.000
159 73 156 1.000
160 74 75 1.000
161 74 76 1.000
162 74 154 1.000
163 74 155 1.000
164 74 156 1.000
165 75 76 1.000
166 75 77 1.000
167 75 78 1.000
168 75 152 1.000
169 75 153 1.000
170 75 154 1.000
171 75 155 1.000
172 76 77 1.000
173 76 78 1.000
174 76 152 1.000
175 76 153 1.000
176 76 154 1.000
177 77 78 1.000
178 77 79 1.000
179 77 152 1.000
180 77 153 1.000
181 78 79 1.000
182 78 80 1.000
183 78 150 1.000
184 78 151 1.000
185 78 152 1.000
186 79 80 1.000
187 79 81 1.000
188 79 150 1.000
189 79 151 1.000
190 79 152 1.000
191 80 81 1.000
192 80 82 1.000
193 80 148 1.000
194 80 149 1.000
195 80 150 1.000
196 81 82 1.000
197 81 83 1.000
198 81 148 1.000
199 81 149 1.000
200 82 83 1.000
201 82 84 1.000
202 82 85 1.000
203 82 146 1.000
204 82 147 1.000
205 82 148 1.000
206 82 149 1.000
207 83 84 1.000
208 83 85 1.000
209 83 146 1.000
210 83 147 1.000
211 84 85 1.000
212 84 86 1.000
213 84 146 1.000
214 84 147 1.000
215 85 86 1.000
216 85 87 1.000
217 85 144 1.000
218 85 145 1.000
219 85 146 1.000
220 85 147 1.000
221 86 87 1.000
222 86 88 1.000
223 86 144 1.000
224 86 145 1.000
225 87 88 1.000
226 87 89 1.000
227 87 90 1.000
228 87 91 1.000
229 87 142 1.000
230 87 143 1.000
231 87 144 1.000
232 87 145 1.000
233 88 89 1.000
234 88 90 1.000
235 88 143 1.000
236 88 144 1.000
237 89 90 1.000
238 89 91 1.000
239 89 142 1.000
240 89 143 1.000
241 89 144 1.000
242 90 91 1.000
243 90 92 1.000
244 90 142 1.000
245 90 143 1.000
246 90 165 1.000
247 91 92 1.000
248 91 93 1.000
249 91 139 1.000
250 91 140 1.000
251 91 141 1.000
252 91 142 1.000
253 91 164 1.000
254 91 165 1.000
255 92 93 1.000
256 92 94 1.000
257 92 137 1.000
258 92 138 1.000
259 92 139 1.000
260 92 140 1.000
261 92 141 1.000
262 92 164 1.000
263 92 165 1.000
264 92 166 1.000
265 93 94 1.000
266 93 95 1.000
267 93 137 1.000
268 93 138 1.000
269 93 139 1.000
270 93 162 1.000
271 93 163 1.000
272 93 164 1.000
273 93 166 1.000
274 94 95 1.000
275 94 96 1.000
276 94 135 1.000
277 94 136 1.000
278 94 137 1.000
279 94 162 1.000
280 94 163 1.000
281 94 164 1.000
282 95 96 1.000
283 95 97 1.000
284 95 135 1.000
285 95 136 1.000
286 95 160 1.000
287 95 161 1.000
288 95 162 1.000
289 96 97 1.000
290 96 98 1.000
291 96 133 1.000
292 96 134 1.000
293 96 135 1.000
294 96 160 1.000
295 96 161 1.000
296 97 98 1.000
297 97 99 1.000
298 97 133 1.000
299 97 134 1.000
300 97 157 1.000
301 97 158 1.000
302 97 159 1.000
303 97 160 1.000
304 97 161 1.000
305 98 99 1.000
306 98 100 1.000
307 98 131 1.000
308 98 132 1.000
309 98 133 1.000
310 98 157 1.000
311 98 158 1.000
312 98 159 1.000
313 99 100 1.000
314 99 101 1.000
315 99 128 1.000
316 99 129 1.000
317 99 131 1.000
318 99 132 1.000
319 99 156 1.000
320 99 157 1.000
321 100 101 1.000
322 100 102 1.000
323 100 124 1.000
324 100 125 1.000
325 100 126 1.000
326 100 127 1.000
327 100 128 1.000
328 100 129 1.000
329 100 131 1.000
330 100 155 1.000
331 100 156 1.000
332 101 102 1.000
333 101 103 1.000
334 101 125 1.000
335 101 126 1.000
336 101 127 1.000
337 101 128 1.000
338 101 129 1.000
339 102 103 1.000
340 102 104 1.000
341 102 123 1.000
342 102 124 1.000
343 102 125 1.000
344 102 155 1.000
345 103 104 1.000
346 103 105 1.000
347 103 123 1.000
348 103 124 1.000
349 103 125 1.000
350 104 105 1.000
351 104 106 1.000
352 104 121 1.000
353 104 122 1.000
354 104 123 1.000
355 104 124 1.000
356 105 106 1.000
357 105 107 1.000
358 105 121 1.000
359 105 122 1.000
360 105 123 1.000
361 105 151 1.000
362 105 152 1.000
363 105 153 1.000
364 105 154 1.000
365 106 107 1.000
366 106 108 1.000
367 106 119 1.000
368 106 120 1.000
369 106 121 1.000
370 106 151 1.000
371 106 152 1.000
372 107 108 1.000
373 107 109 1.000
374 107 119 1.000
375 107 120 1.000
376 107 121 1.000
377 107 149 1.000
378 107 150 1.000
379 107 151 1.000
380 108 109 1.000
381 108 110 1.000
382 108 116 1.000
383 108 117 1.000
384 108 118 1.000
385 108 119 1.000
386 108 120 1.000
387 108 149 1.000
388 108 150 1.000
389 109 110 1.000
390 109 111 1.000
391 109 112 1.000
392 109 115 1.000
393 109 116 1.000
394 109 117 1.000
395 109 118 1.000
396 109 147 1.000
397 109 148 1.000
398 109 149 1.000
399 110 111 1.000
400 110 112 1.000
401 110 115 1.000
402 110 116 1.000
403 110 147 1.000
404 111 112 1.000
405 111 113 1.000
406 111 147 1.000
407 111 148 1.000
408 111 149 1.000
409 112 113 1.000
410 112 114 1.000
411 112 115 1.000
412 113 114 1.000
413 113 115 1.000
414 114 115 1.000
415 114 116 1.000
416 115 116 1.000
417 115 117 1.000
418 116 117 1.000
419 116 118 1.000
420 117 118 1.000
421 117 119 1.000
422 118 119 1.000
423 118 120 1.000
424 118 138 1.000
425 118 139 1.000
426 118 140 1.000
427 119 120 1.000
428 119 121 1.000
429 119 138 1.000
430 119 139 1.000
431 120 121 1.000
432 120 122 1.000
433 120 137 1.000
434 120 138 1.000
435 121 122 1.000
436 121 123 1.000
437 122 123 1.000
438 122 124 1.000
439 123 124 1.000
440 123 125 1.000
441 124 125 1.000
442 124 126 1.000
443 125 126 1.000
444 125 127 1.000
445 126 127 1.000
446 126 128 1.000
447 126 131 1.000
448 127 128 1.000
449 127 129 1.000
450 128 129 1.000
451 128 130 1.000
452 128 131 1.000
453 129 130 1.000
454 129 131 1.000
455 130 131 1.000
456 130 132 1.000
457 131 132 1.000
458 131 133 1.000
459 132 133 1.000
460 132 134 1.000
461 133 134 1.000
462 133 135 1.000
463 134 135 1.000
464 134 136 1.000
465 135 136 1.000
466 135 137 1.000
467 136 137 1.000
468 136 138 1.000
469 137 138 1.000
470 137 139 1.000
471 138 139 1.000
472 138 140 1.000
473 139 140 1.000
474 139 141 1.000
475 140 141 1.000
476 140 142 1.000
477 141 142 1.000
478 141 143 1.000
479 142 143 1.000
480 142 144 1.000
481 143 144 1.000
482 143 145 1.000
483 144 145 1.000
484 144 146 1.000
485 145 146 1.000
486 145 147 1.000
487 146 147 1.000
488 146 148 1.000
489 147 148 1.000
490 147 149 1.000
491 148 149 1.000
492 148 150 1.000
493 149 150 1.000
494 149 151 1.000
495 150 151 1.000
496 150 152 1.000
497 151 152 1.000
498 151 153 1.000
499 152 153 1.000
500 152 154 1.000
501 153 154 1.000
502 153 155 1.000
503 154 155 1.000
504 154 156 1.000
505 155 156 1.000
506 155 157 1.000
507 156 157 1.000
508 156 158 1.000
509 157 158 1.000
510 157 159 1.000
511 158 159 1.000
512 158 160 1.000
513 159 160 1.000
514 159 161 1.000
515 160 161 1.000
516 160 162 1.000
517 161 162 1.000
518 161 163 1.000
519 162 163 1.000
520 162 164 1.000
521 163 164 1.000
522 163 165 1.000
523 164 165 1.000
524 164 166 1.000
525 165 166 1.000
526 165 167 1.000
527 166 167 1.000