ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1od3A_Ca_8.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 11 months ago) by duarte
File size: 9726 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line User Rev File contents
1 duarte 884 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: MGSSHHHHHHSSGLVPRGSHMASTPANVNSGPTSPVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSKSGT
3     #PDB: 1od3
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: Ca
8     #CUTOFF: 8.0
9     36 37 1.000
10     36 38 1.000
11     37 38 1.000
12     37 39 1.000
13     37 40 1.000
14     38 39 1.000
15     38 40 1.000
16     39 40 1.000
17     39 41 1.000
18     39 84 1.000
19     39 85 1.000
20     39 86 1.000
21     40 41 1.000
22     40 42 1.000
23     40 46 1.000
24     40 84 1.000
25     40 85 1.000
26     40 86 1.000
27     41 42 1.000
28     41 43 1.000
29     41 44 1.000
30     41 85 1.000
31     41 86 1.000
32     41 87 1.000
33     42 43 1.000
34     42 44 1.000
35     42 45 1.000
36     42 46 1.000
37     42 85 1.000
38     42 86 1.000
39     42 87 1.000
40     42 91 1.000
41     42 162 1.000
42     42 163 1.000
43     42 164 1.000
44     43 44 1.000
45     43 45 1.000
46     43 87 1.000
47     43 162 1.000
48     43 163 1.000
49     43 164 1.000
50     44 45 1.000
51     44 46 1.000
52     44 162 1.000
53     44 163 1.000
54     45 46 1.000
55     45 47 1.000
56     45 160 1.000
57     45 161 1.000
58     45 162 1.000
59     46 47 1.000
60     46 48 1.000
61     46 50 1.000
62     46 160 1.000
63     46 161 1.000
64     46 162 1.000
65     47 48 1.000
66     47 49 1.000
67     47 50 1.000
68     47 51 1.000
69     47 70 1.000
70     47 159 1.000
71     47 160 1.000
72     47 161 1.000
73     48 49 1.000
74     48 50 1.000
75     48 51 1.000
76     48 70 1.000
77     48 71 1.000
78     48 158 1.000
79     48 159 1.000
80     48 160 1.000
81     48 161 1.000
82     49 50 1.000
83     49 51 1.000
84     49 61 1.000
85     49 69 1.000
86     49 70 1.000
87     49 71 1.000
88     49 159 1.000
89     49 160 1.000
90     50 51 1.000
91     50 52 1.000
92     50 82 1.000
93     51 52 1.000
94     51 53 1.000
95     51 54 1.000
96     51 80 1.000
97     51 81 1.000
98     51 82 1.000
99     51 83 1.000
100     52 53 1.000
101     52 54 1.000
102     52 80 1.000
103     52 81 1.000
104     52 82 1.000
105     52 83 1.000
106     53 54 1.000
107     53 55 1.000
108     53 80 1.000
109     53 81 1.000
110     53 82 1.000
111     54 55 1.000
112     54 56 1.000
113     54 78 1.000
114     54 79 1.000
115     54 80 1.000
116     54 81 1.000
117     55 56 1.000
118     55 57 1.000
119     55 77 1.000
120     55 78 1.000
121     55 79 1.000
122     55 80 1.000
123     56 57 1.000
124     56 58 1.000
125     56 59 1.000
126     56 74 1.000
127     56 75 1.000
128     56 78 1.000
129     56 79 1.000
130     57 58 1.000
131     57 59 1.000
132     58 59 1.000
133     58 60 1.000
134     58 73 1.000
135     58 74 1.000
136     59 60 1.000
137     59 61 1.000
138     59 71 1.000
139     59 72 1.000
140     59 73 1.000
141     59 74 1.000
142     60 61 1.000
143     60 62 1.000
144     60 71 1.000
145     60 72 1.000
146     60 73 1.000
147     60 74 1.000
148     61 62 1.000
149     61 63 1.000
150     61 69 1.000
151     61 70 1.000
152     61 71 1.000
153     61 72 1.000
154     62 63 1.000
155     62 64 1.000
156     62 69 1.000
157     62 70 1.000
158     62 71 1.000
159     62 72 1.000
160     63 64 1.000
161     63 65 1.000
162     63 67 1.000
163     63 68 1.000
164     63 69 1.000
165     63 70 1.000
166     64 65 1.000
167     64 66 1.000
168     64 67 1.000
169     64 68 1.000
170     64 69 1.000
171     64 70 1.000
172     65 66 1.000
173     65 67 1.000
174     65 68 1.000
175     66 67 1.000
176     66 68 1.000
177     67 68 1.000
178     67 69 1.000
179     68 69 1.000
180     68 70 1.000
181     68 159 1.000
182     69 70 1.000
183     69 71 1.000
184     69 159 1.000
185     70 71 1.000
186     70 72 1.000
187     70 157 1.000
188     70 158 1.000
189     70 159 1.000
190     70 160 1.000
191     71 72 1.000
192     71 73 1.000
193     71 74 1.000
194     71 157 1.000
195     71 158 1.000
196     71 159 1.000
197     72 73 1.000
198     72 74 1.000
199     72 155 1.000
200     72 156 1.000
201     72 157 1.000
202     72 158 1.000
203     73 74 1.000
204     73 75 1.000
205     73 155 1.000
206     73 156 1.000
207     73 157 1.000
208     74 75 1.000
209     74 76 1.000
210     74 78 1.000
211     74 152 1.000
212     74 154 1.000
213     74 155 1.000
214     74 156 1.000
215     74 157 1.000
216     75 76 1.000
217     75 77 1.000
218     75 78 1.000
219     75 152 1.000
220     75 153 1.000
221     75 154 1.000
222     75 155 1.000
223     76 77 1.000
224     76 78 1.000
225     76 152 1.000
226     76 153 1.000
227     76 154 1.000
228     76 155 1.000
229     77 78 1.000
230     77 79 1.000
231     77 151 1.000
232     77 152 1.000
233     77 153 1.000
234     77 154 1.000
235     78 79 1.000
236     78 80 1.000
237     78 151 1.000
238     78 152 1.000
239     78 153 1.000
240     79 80 1.000
241     79 81 1.000
242     79 113 1.000
243     79 149 1.000
244     79 150 1.000
245     79 151 1.000
246     79 152 1.000
247     80 81 1.000
248     80 82 1.000
249     80 149 1.000
250     80 150 1.000
251     80 151 1.000
252     81 82 1.000
253     81 83 1.000
254     81 111 1.000
255     81 112 1.000
256     81 147 1.000
257     81 148 1.000
258     81 149 1.000
259     81 150 1.000
260     82 83 1.000
261     82 84 1.000
262     82 85 1.000
263     82 147 1.000
264     82 148 1.000
265     82 149 1.000
266     83 84 1.000
267     83 85 1.000
268     83 146 1.000
269     83 147 1.000
270     83 148 1.000
271     84 85 1.000
272     84 86 1.000
273     84 145 1.000
274     84 146 1.000
275     84 147 1.000
276     84 148 1.000
277     85 86 1.000
278     85 87 1.000
279     85 145 1.000
280     85 146 1.000
281     85 147 1.000
282     85 148 1.000
283     86 87 1.000
284     86 88 1.000
285     86 143 1.000
286     86 144 1.000
287     86 145 1.000
288     86 146 1.000
289     87 88 1.000
290     87 89 1.000
291     87 90 1.000
292     87 91 1.000
293     87 142 1.000
294     87 143 1.000
295     87 144 1.000
296     87 145 1.000
297     87 146 1.000
298     88 89 1.000
299     88 90 1.000
300     88 143 1.000
301     88 144 1.000
302     88 145 1.000
303     89 90 1.000
304     89 91 1.000
305     89 142 1.000
306     89 143 1.000
307     89 144 1.000
308     90 91 1.000
309     90 92 1.000
310     90 141 1.000
311     90 142 1.000
312     90 143 1.000
313     90 144 1.000
314     90 165 1.000
315     91 92 1.000
316     91 93 1.000
317     91 139 1.000
318     91 140 1.000
319     91 141 1.000
320     91 142 1.000
321     91 143 1.000
322     91 163 1.000
323     91 164 1.000
324     91 165 1.000
325     91 166 1.000
326     92 93 1.000
327     92 94 1.000
328     92 138 1.000
329     92 139 1.000
330     92 140 1.000
331     92 141 1.000
332     92 142 1.000
333     92 163 1.000
334     92 164 1.000
335     92 165 1.000
336     92 166 1.000
337     93 94 1.000
338     93 95 1.000
339     93 136 1.000
340     93 137 1.000
341     93 138 1.000
342     93 139 1.000
343     93 163 1.000
344     93 164 1.000
345     93 165 1.000
346     93 166 1.000
347     94 95 1.000
348     94 96 1.000
349     94 136 1.000
350     94 137 1.000
351     94 138 1.000
352     94 139 1.000
353     94 161 1.000
354     94 162 1.000
355     94 163 1.000
356     94 164 1.000
357     95 96 1.000
358     95 97 1.000
359     95 134 1.000
360     95 135 1.000
361     95 136 1.000
362     95 137 1.000
363     95 161 1.000
364     95 162 1.000
365     95 163 1.000
366     96 97 1.000
367     96 98 1.000
368     96 134 1.000
369     96 135 1.000
370     96 136 1.000
371     96 158 1.000
372     96 159 1.000
373     96 160 1.000
374     96 161 1.000
375     96 162 1.000
376     97 98 1.000
377     97 99 1.000
378     97 132 1.000
379     97 133 1.000
380     97 134 1.000
381     97 135 1.000
382     97 158 1.000
383     97 159 1.000
384     97 160 1.000
385     97 161 1.000
386     98 99 1.000
387     98 100 1.000
388     98 123 1.000
389     98 131 1.000
390     98 132 1.000
391     98 133 1.000
392     98 134 1.000
393     98 135 1.000
394     98 156 1.000
395     98 157 1.000
396     98 158 1.000
397     98 159 1.000
398     98 160 1.000
399     99 100 1.000
400     99 101 1.000
401     99 125 1.000
402     99 126 1.000
403     99 127 1.000
404     99 128 1.000
405     99 129 1.000
406     99 130 1.000
407     99 131 1.000
408     99 132 1.000
409     99 133 1.000
410     99 156 1.000
411     99 157 1.000
412     99 158 1.000
413     100 101 1.000
414     100 102 1.000
415     100 103 1.000
416     100 123 1.000
417     100 124 1.000
418     100 125 1.000
419     100 126 1.000
420     100 127 1.000
421     100 128 1.000
422     100 129 1.000
423     100 130 1.000
424     100 131 1.000
425     100 155 1.000
426     100 156 1.000
427     100 157 1.000
428     101 102 1.000
429     101 103 1.000
430     101 124 1.000
431     101 125 1.000
432     101 126 1.000
433     101 127 1.000
434     101 128 1.000
435     101 129 1.000
436     101 156 1.000
437     102 103 1.000
438     102 104 1.000
439     102 124 1.000
440     102 125 1.000
441     102 155 1.000
442     103 104 1.000
443     103 105 1.000
444     103 122 1.000
445     103 123 1.000
446     103 124 1.000
447     103 125 1.000
448     104 105 1.000
449     104 106 1.000
450     104 122 1.000
451     104 123 1.000
452     104 124 1.000
453     104 153 1.000
454     104 154 1.000
455     104 155 1.000
456     104 156 1.000
457     105 106 1.000
458     105 107 1.000
459     105 120 1.000
460     105 121 1.000
461     105 122 1.000
462     105 123 1.000
463     105 152 1.000
464     105 153 1.000
465     105 154 1.000
466     106 107 1.000
467     106 108 1.000
468     106 120 1.000
469     106 121 1.000
470     106 122 1.000
471     106 123 1.000
472     106 150 1.000
473     106 151 1.000
474     106 152 1.000
475     106 153 1.000
476     107 108 1.000
477     107 109 1.000
478     107 117 1.000
479     107 118 1.000
480     107 119 1.000
481     107 120 1.000
482     107 121 1.000
483     107 149 1.000
484     107 150 1.000
485     107 151 1.000
486     107 152 1.000
487     108 109 1.000
488     108 110 1.000
489     108 117 1.000
490     108 118 1.000
491     108 119 1.000
492     108 120 1.000
493     108 121 1.000
494     108 148 1.000
495     108 149 1.000
496     108 150 1.000
497     108 151 1.000
498     109 110 1.000
499     109 111 1.000
500     109 112 1.000
501     109 113 1.000
502     109 114 1.000
503     109 115 1.000
504     109 116 1.000
505     109 117 1.000
506     109 118 1.000
507     109 119 1.000
508     109 148 1.000
509     109 149 1.000
510     109 150 1.000
511     109 151 1.000
512     110 111 1.000
513     110 112 1.000
514     110 113 1.000
515     110 115 1.000
516     110 116 1.000
517     110 117 1.000
518     110 118 1.000
519     110 146 1.000
520     110 147 1.000
521     110 148 1.000
522     110 149 1.000
523     111 112 1.000
524     111 113 1.000
525     111 115 1.000
526     111 116 1.000
527     111 146 1.000
528     111 147 1.000
529     111 148 1.000
530     111 149 1.000
531     112 113 1.000
532     112 114 1.000
533     112 115 1.000
534     112 147 1.000
535     112 148 1.000
536     112 149 1.000
537     113 114 1.000
538     113 115 1.000
539     113 149 1.000
540     113 150 1.000
541     113 151 1.000
542     114 115 1.000
543     114 116 1.000
544     115 116 1.000
545     115 117 1.000
546     116 117 1.000
547     116 118 1.000
548     117 118 1.000
549     117 119 1.000
550     117 120 1.000
551     118 119 1.000
552     118 120 1.000
553     118 139 1.000
554     118 140 1.000
555     118 141 1.000
556     118 142 1.000
557     119 120 1.000
558     119 121 1.000
559     119 137 1.000
560     119 138 1.000
561     119 139 1.000
562     119 140 1.000
563     120 121 1.000
564     120 122 1.000
565     120 137 1.000
566     120 138 1.000
567     120 139 1.000
568     121 122 1.000
569     121 123 1.000
570     121 135 1.000
571     121 136 1.000
572     121 137 1.000
573     122 123 1.000
574     122 124 1.000
575     122 135 1.000
576     122 136 1.000
577     122 137 1.000
578     123 124 1.000
579     123 125 1.000
580     123 135 1.000
581     124 125 1.000
582     124 126 1.000
583     125 126 1.000
584     125 127 1.000
585     125 128 1.000
586     126 127 1.000
587     126 128 1.000
588     126 129 1.000
589     126 131 1.000
590     126 132 1.000
591     126 133 1.000
592     127 128 1.000
593     127 129 1.000
594     127 131 1.000
595     128 129 1.000
596     128 130 1.000
597     128 131 1.000
598     129 130 1.000
599     129 131 1.000
600     129 132 1.000
601     129 156 1.000
602     129 157 1.000
603     130 131 1.000
604     130 132 1.000
605     131 132 1.000
606     131 133 1.000
607     132 133 1.000
608     132 134 1.000
609     133 134 1.000
610     133 135 1.000
611     134 135 1.000
612     134 136 1.000
613     135 136 1.000
614     135 137 1.000
615     136 137 1.000
616     136 138 1.000
617     137 138 1.000
618     137 139 1.000
619     138 139 1.000
620     138 140 1.000
621     138 166 1.000
622     139 140 1.000
623     139 141 1.000
624     139 142 1.000
625     140 141 1.000
626     140 142 1.000
627     141 142 1.000
628     141 143 1.000
629     142 143 1.000
630     142 144 1.000
631     143 144 1.000
632     143 145 1.000
633     143 146 1.000
634     144 145 1.000
635     144 146 1.000
636     145 146 1.000
637     145 147 1.000
638     146 147 1.000
639     146 148 1.000
640     147 148 1.000
641     147 149 1.000
642     148 149 1.000
643     148 150 1.000
644     149 150 1.000
645     149 151 1.000
646     150 151 1.000
647     150 152 1.000
648     151 152 1.000
649     151 153 1.000
650     152 153 1.000
651     152 154 1.000
652     152 155 1.000
653     152 156 1.000
654     153 154 1.000
655     153 155 1.000
656     154 155 1.000
657     154 156 1.000
658     155 156 1.000
659     155 157 1.000
660     156 157 1.000
661     156 158 1.000
662     157 158 1.000
663     157 159 1.000
664     158 159 1.000
665     158 160 1.000
666     158 161 1.000
667     159 160 1.000
668     159 161 1.000
669     160 161 1.000
670     160 162 1.000
671     161 162 1.000
672     161 163 1.000
673     162 163 1.000
674     162 164 1.000
675     163 164 1.000
676     163 165 1.000
677     164 165 1.000
678     164 166 1.000
679     165 166 1.000