ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1od3A_Ca_8.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 9726 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: MGSSHHHHHHSSGLVPRGSHMASTPANVNSGPTSPVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSKSGT
3 #PDB: 1od3
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: Ca
8 #CUTOFF: 8.0
9 36 37 1.000
10 36 38 1.000
11 37 38 1.000
12 37 39 1.000
13 37 40 1.000
14 38 39 1.000
15 38 40 1.000
16 39 40 1.000
17 39 41 1.000
18 39 84 1.000
19 39 85 1.000
20 39 86 1.000
21 40 41 1.000
22 40 42 1.000
23 40 46 1.000
24 40 84 1.000
25 40 85 1.000
26 40 86 1.000
27 41 42 1.000
28 41 43 1.000
29 41 44 1.000
30 41 85 1.000
31 41 86 1.000
32 41 87 1.000
33 42 43 1.000
34 42 44 1.000
35 42 45 1.000
36 42 46 1.000
37 42 85 1.000
38 42 86 1.000
39 42 87 1.000
40 42 91 1.000
41 42 162 1.000
42 42 163 1.000
43 42 164 1.000
44 43 44 1.000
45 43 45 1.000
46 43 87 1.000
47 43 162 1.000
48 43 163 1.000
49 43 164 1.000
50 44 45 1.000
51 44 46 1.000
52 44 162 1.000
53 44 163 1.000
54 45 46 1.000
55 45 47 1.000
56 45 160 1.000
57 45 161 1.000
58 45 162 1.000
59 46 47 1.000
60 46 48 1.000
61 46 50 1.000
62 46 160 1.000
63 46 161 1.000
64 46 162 1.000
65 47 48 1.000
66 47 49 1.000
67 47 50 1.000
68 47 51 1.000
69 47 70 1.000
70 47 159 1.000
71 47 160 1.000
72 47 161 1.000
73 48 49 1.000
74 48 50 1.000
75 48 51 1.000
76 48 70 1.000
77 48 71 1.000
78 48 158 1.000
79 48 159 1.000
80 48 160 1.000
81 48 161 1.000
82 49 50 1.000
83 49 51 1.000
84 49 61 1.000
85 49 69 1.000
86 49 70 1.000
87 49 71 1.000
88 49 159 1.000
89 49 160 1.000
90 50 51 1.000
91 50 52 1.000
92 50 82 1.000
93 51 52 1.000
94 51 53 1.000
95 51 54 1.000
96 51 80 1.000
97 51 81 1.000
98 51 82 1.000
99 51 83 1.000
100 52 53 1.000
101 52 54 1.000
102 52 80 1.000
103 52 81 1.000
104 52 82 1.000
105 52 83 1.000
106 53 54 1.000
107 53 55 1.000
108 53 80 1.000
109 53 81 1.000
110 53 82 1.000
111 54 55 1.000
112 54 56 1.000
113 54 78 1.000
114 54 79 1.000
115 54 80 1.000
116 54 81 1.000
117 55 56 1.000
118 55 57 1.000
119 55 77 1.000
120 55 78 1.000
121 55 79 1.000
122 55 80 1.000
123 56 57 1.000
124 56 58 1.000
125 56 59 1.000
126 56 74 1.000
127 56 75 1.000
128 56 78 1.000
129 56 79 1.000
130 57 58 1.000
131 57 59 1.000
132 58 59 1.000
133 58 60 1.000
134 58 73 1.000
135 58 74 1.000
136 59 60 1.000
137 59 61 1.000
138 59 71 1.000
139 59 72 1.000
140 59 73 1.000
141 59 74 1.000
142 60 61 1.000
143 60 62 1.000
144 60 71 1.000
145 60 72 1.000
146 60 73 1.000
147 60 74 1.000
148 61 62 1.000
149 61 63 1.000
150 61 69 1.000
151 61 70 1.000
152 61 71 1.000
153 61 72 1.000
154 62 63 1.000
155 62 64 1.000
156 62 69 1.000
157 62 70 1.000
158 62 71 1.000
159 62 72 1.000
160 63 64 1.000
161 63 65 1.000
162 63 67 1.000
163 63 68 1.000
164 63 69 1.000
165 63 70 1.000
166 64 65 1.000
167 64 66 1.000
168 64 67 1.000
169 64 68 1.000
170 64 69 1.000
171 64 70 1.000
172 65 66 1.000
173 65 67 1.000
174 65 68 1.000
175 66 67 1.000
176 66 68 1.000
177 67 68 1.000
178 67 69 1.000
179 68 69 1.000
180 68 70 1.000
181 68 159 1.000
182 69 70 1.000
183 69 71 1.000
184 69 159 1.000
185 70 71 1.000
186 70 72 1.000
187 70 157 1.000
188 70 158 1.000
189 70 159 1.000
190 70 160 1.000
191 71 72 1.000
192 71 73 1.000
193 71 74 1.000
194 71 157 1.000
195 71 158 1.000
196 71 159 1.000
197 72 73 1.000
198 72 74 1.000
199 72 155 1.000
200 72 156 1.000
201 72 157 1.000
202 72 158 1.000
203 73 74 1.000
204 73 75 1.000
205 73 155 1.000
206 73 156 1.000
207 73 157 1.000
208 74 75 1.000
209 74 76 1.000
210 74 78 1.000
211 74 152 1.000
212 74 154 1.000
213 74 155 1.000
214 74 156 1.000
215 74 157 1.000
216 75 76 1.000
217 75 77 1.000
218 75 78 1.000
219 75 152 1.000
220 75 153 1.000
221 75 154 1.000
222 75 155 1.000
223 76 77 1.000
224 76 78 1.000
225 76 152 1.000
226 76 153 1.000
227 76 154 1.000
228 76 155 1.000
229 77 78 1.000
230 77 79 1.000
231 77 151 1.000
232 77 152 1.000
233 77 153 1.000
234 77 154 1.000
235 78 79 1.000
236 78 80 1.000
237 78 151 1.000
238 78 152 1.000
239 78 153 1.000
240 79 80 1.000
241 79 81 1.000
242 79 113 1.000
243 79 149 1.000
244 79 150 1.000
245 79 151 1.000
246 79 152 1.000
247 80 81 1.000
248 80 82 1.000
249 80 149 1.000
250 80 150 1.000
251 80 151 1.000
252 81 82 1.000
253 81 83 1.000
254 81 111 1.000
255 81 112 1.000
256 81 147 1.000
257 81 148 1.000
258 81 149 1.000
259 81 150 1.000
260 82 83 1.000
261 82 84 1.000
262 82 85 1.000
263 82 147 1.000
264 82 148 1.000
265 82 149 1.000
266 83 84 1.000
267 83 85 1.000
268 83 146 1.000
269 83 147 1.000
270 83 148 1.000
271 84 85 1.000
272 84 86 1.000
273 84 145 1.000
274 84 146 1.000
275 84 147 1.000
276 84 148 1.000
277 85 86 1.000
278 85 87 1.000
279 85 145 1.000
280 85 146 1.000
281 85 147 1.000
282 85 148 1.000
283 86 87 1.000
284 86 88 1.000
285 86 143 1.000
286 86 144 1.000
287 86 145 1.000
288 86 146 1.000
289 87 88 1.000
290 87 89 1.000
291 87 90 1.000
292 87 91 1.000
293 87 142 1.000
294 87 143 1.000
295 87 144 1.000
296 87 145 1.000
297 87 146 1.000
298 88 89 1.000
299 88 90 1.000
300 88 143 1.000
301 88 144 1.000
302 88 145 1.000
303 89 90 1.000
304 89 91 1.000
305 89 142 1.000
306 89 143 1.000
307 89 144 1.000
308 90 91 1.000
309 90 92 1.000
310 90 141 1.000
311 90 142 1.000
312 90 143 1.000
313 90 144 1.000
314 90 165 1.000
315 91 92 1.000
316 91 93 1.000
317 91 139 1.000
318 91 140 1.000
319 91 141 1.000
320 91 142 1.000
321 91 143 1.000
322 91 163 1.000
323 91 164 1.000
324 91 165 1.000
325 91 166 1.000
326 92 93 1.000
327 92 94 1.000
328 92 138 1.000
329 92 139 1.000
330 92 140 1.000
331 92 141 1.000
332 92 142 1.000
333 92 163 1.000
334 92 164 1.000
335 92 165 1.000
336 92 166 1.000
337 93 94 1.000
338 93 95 1.000
339 93 136 1.000
340 93 137 1.000
341 93 138 1.000
342 93 139 1.000
343 93 163 1.000
344 93 164 1.000
345 93 165 1.000
346 93 166 1.000
347 94 95 1.000
348 94 96 1.000
349 94 136 1.000
350 94 137 1.000
351 94 138 1.000
352 94 139 1.000
353 94 161 1.000
354 94 162 1.000
355 94 163 1.000
356 94 164 1.000
357 95 96 1.000
358 95 97 1.000
359 95 134 1.000
360 95 135 1.000
361 95 136 1.000
362 95 137 1.000
363 95 161 1.000
364 95 162 1.000
365 95 163 1.000
366 96 97 1.000
367 96 98 1.000
368 96 134 1.000
369 96 135 1.000
370 96 136 1.000
371 96 158 1.000
372 96 159 1.000
373 96 160 1.000
374 96 161 1.000
375 96 162 1.000
376 97 98 1.000
377 97 99 1.000
378 97 132 1.000
379 97 133 1.000
380 97 134 1.000
381 97 135 1.000
382 97 158 1.000
383 97 159 1.000
384 97 160 1.000
385 97 161 1.000
386 98 99 1.000
387 98 100 1.000
388 98 123 1.000
389 98 131 1.000
390 98 132 1.000
391 98 133 1.000
392 98 134 1.000
393 98 135 1.000
394 98 156 1.000
395 98 157 1.000
396 98 158 1.000
397 98 159 1.000
398 98 160 1.000
399 99 100 1.000
400 99 101 1.000
401 99 125 1.000
402 99 126 1.000
403 99 127 1.000
404 99 128 1.000
405 99 129 1.000
406 99 130 1.000
407 99 131 1.000
408 99 132 1.000
409 99 133 1.000
410 99 156 1.000
411 99 157 1.000
412 99 158 1.000
413 100 101 1.000
414 100 102 1.000
415 100 103 1.000
416 100 123 1.000
417 100 124 1.000
418 100 125 1.000
419 100 126 1.000
420 100 127 1.000
421 100 128 1.000
422 100 129 1.000
423 100 130 1.000
424 100 131 1.000
425 100 155 1.000
426 100 156 1.000
427 100 157 1.000
428 101 102 1.000
429 101 103 1.000
430 101 124 1.000
431 101 125 1.000
432 101 126 1.000
433 101 127 1.000
434 101 128 1.000
435 101 129 1.000
436 101 156 1.000
437 102 103 1.000
438 102 104 1.000
439 102 124 1.000
440 102 125 1.000
441 102 155 1.000
442 103 104 1.000
443 103 105 1.000
444 103 122 1.000
445 103 123 1.000
446 103 124 1.000
447 103 125 1.000
448 104 105 1.000
449 104 106 1.000
450 104 122 1.000
451 104 123 1.000
452 104 124 1.000
453 104 153 1.000
454 104 154 1.000
455 104 155 1.000
456 104 156 1.000
457 105 106 1.000
458 105 107 1.000
459 105 120 1.000
460 105 121 1.000
461 105 122 1.000
462 105 123 1.000
463 105 152 1.000
464 105 153 1.000
465 105 154 1.000
466 106 107 1.000
467 106 108 1.000
468 106 120 1.000
469 106 121 1.000
470 106 122 1.000
471 106 123 1.000
472 106 150 1.000
473 106 151 1.000
474 106 152 1.000
475 106 153 1.000
476 107 108 1.000
477 107 109 1.000
478 107 117 1.000
479 107 118 1.000
480 107 119 1.000
481 107 120 1.000
482 107 121 1.000
483 107 149 1.000
484 107 150 1.000
485 107 151 1.000
486 107 152 1.000
487 108 109 1.000
488 108 110 1.000
489 108 117 1.000
490 108 118 1.000
491 108 119 1.000
492 108 120 1.000
493 108 121 1.000
494 108 148 1.000
495 108 149 1.000
496 108 150 1.000
497 108 151 1.000
498 109 110 1.000
499 109 111 1.000
500 109 112 1.000
501 109 113 1.000
502 109 114 1.000
503 109 115 1.000
504 109 116 1.000
505 109 117 1.000
506 109 118 1.000
507 109 119 1.000
508 109 148 1.000
509 109 149 1.000
510 109 150 1.000
511 109 151 1.000
512 110 111 1.000
513 110 112 1.000
514 110 113 1.000
515 110 115 1.000
516 110 116 1.000
517 110 117 1.000
518 110 118 1.000
519 110 146 1.000
520 110 147 1.000
521 110 148 1.000
522 110 149 1.000
523 111 112 1.000
524 111 113 1.000
525 111 115 1.000
526 111 116 1.000
527 111 146 1.000
528 111 147 1.000
529 111 148 1.000
530 111 149 1.000
531 112 113 1.000
532 112 114 1.000
533 112 115 1.000
534 112 147 1.000
535 112 148 1.000
536 112 149 1.000
537 113 114 1.000
538 113 115 1.000
539 113 149 1.000
540 113 150 1.000
541 113 151 1.000
542 114 115 1.000
543 114 116 1.000
544 115 116 1.000
545 115 117 1.000
546 116 117 1.000
547 116 118 1.000
548 117 118 1.000
549 117 119 1.000
550 117 120 1.000
551 118 119 1.000
552 118 120 1.000
553 118 139 1.000
554 118 140 1.000
555 118 141 1.000
556 118 142 1.000
557 119 120 1.000
558 119 121 1.000
559 119 137 1.000
560 119 138 1.000
561 119 139 1.000
562 119 140 1.000
563 120 121 1.000
564 120 122 1.000
565 120 137 1.000
566 120 138 1.000
567 120 139 1.000
568 121 122 1.000
569 121 123 1.000
570 121 135 1.000
571 121 136 1.000
572 121 137 1.000
573 122 123 1.000
574 122 124 1.000
575 122 135 1.000
576 122 136 1.000
577 122 137 1.000
578 123 124 1.000
579 123 125 1.000
580 123 135 1.000
581 124 125 1.000
582 124 126 1.000
583 125 126 1.000
584 125 127 1.000
585 125 128 1.000
586 126 127 1.000
587 126 128 1.000
588 126 129 1.000
589 126 131 1.000
590 126 132 1.000
591 126 133 1.000
592 127 128 1.000
593 127 129 1.000
594 127 131 1.000
595 128 129 1.000
596 128 130 1.000
597 128 131 1.000
598 129 130 1.000
599 129 131 1.000
600 129 132 1.000
601 129 156 1.000
602 129 157 1.000
603 130 131 1.000
604 130 132 1.000
605 131 132 1.000
606 131 133 1.000
607 132 133 1.000
608 132 134 1.000
609 133 134 1.000
610 133 135 1.000
611 134 135 1.000
612 134 136 1.000
613 135 136 1.000
614 135 137 1.000
615 136 137 1.000
616 136 138 1.000
617 137 138 1.000
618 137 139 1.000
619 138 139 1.000
620 138 140 1.000
621 138 166 1.000
622 139 140 1.000
623 139 141 1.000
624 139 142 1.000
625 140 141 1.000
626 140 142 1.000
627 141 142 1.000
628 141 143 1.000
629 142 143 1.000
630 142 144 1.000
631 143 144 1.000
632 143 145 1.000
633 143 146 1.000
634 144 145 1.000
635 144 146 1.000
636 145 146 1.000
637 145 147 1.000
638 146 147 1.000
639 146 148 1.000
640 147 148 1.000
641 147 149 1.000
642 148 149 1.000
643 148 150 1.000
644 149 150 1.000
645 149 151 1.000
646 150 151 1.000
647 150 152 1.000
648 151 152 1.000
649 151 153 1.000
650 152 153 1.000
651 152 154 1.000
652 152 155 1.000
653 152 156 1.000
654 153 154 1.000
655 153 155 1.000
656 154 155 1.000
657 154 156 1.000
658 155 156 1.000
659 155 157 1.000
660 156 157 1.000
661 156 158 1.000
662 157 158 1.000
663 157 159 1.000
664 158 159 1.000
665 158 160 1.000
666 158 161 1.000
667 159 160 1.000
668 159 161 1.000
669 160 161 1.000
670 160 162 1.000
671 161 162 1.000
672 161 163 1.000
673 162 163 1.000
674 162 164 1.000
675 163 164 1.000
676 163 165 1.000
677 164 165 1.000
678 164 166 1.000
679 165 166 1.000