ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1od3A_Cb_8.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 9279 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: MGSSHHHHHHSSGLVPRGSHMASTPANVNSGPTSPVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSKSGT
3 #PDB: 1od3
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: Cb
8 #CUTOFF: 8.0
9 36 37 1.000
10 36 38 1.000
11 37 38 1.000
12 37 39 1.000
13 37 40 1.000
14 38 39 1.000
15 38 40 1.000
16 39 40 1.000
17 39 41 1.000
18 39 84 1.000
19 39 85 1.000
20 39 86 1.000
21 39 145 1.000
22 40 41 1.000
23 40 42 1.000
24 40 44 1.000
25 40 46 1.000
26 40 50 1.000
27 40 82 1.000
28 40 84 1.000
29 40 85 1.000
30 40 86 1.000
31 41 42 1.000
32 41 43 1.000
33 41 44 1.000
34 41 85 1.000
35 41 86 1.000
36 42 43 1.000
37 42 44 1.000
38 42 46 1.000
39 42 85 1.000
40 42 86 1.000
41 42 87 1.000
42 42 88 1.000
43 42 90 1.000
44 42 91 1.000
45 42 142 1.000
46 42 162 1.000
47 42 163 1.000
48 43 44 1.000
49 43 91 1.000
50 43 162 1.000
51 43 163 1.000
52 43 164 1.000
53 44 45 1.000
54 44 46 1.000
55 44 162 1.000
56 45 46 1.000
57 45 47 1.000
58 45 160 1.000
59 45 161 1.000
60 45 162 1.000
61 46 47 1.000
62 46 48 1.000
63 46 50 1.000
64 46 82 1.000
65 46 85 1.000
66 46 160 1.000
67 46 161 1.000
68 46 162 1.000
69 47 48 1.000
70 47 49 1.000
71 47 50 1.000
72 47 68 1.000
73 47 69 1.000
74 47 159 1.000
75 47 160 1.000
76 48 49 1.000
77 48 50 1.000
78 48 51 1.000
79 48 70 1.000
80 48 71 1.000
81 48 80 1.000
82 48 96 1.000
83 48 150 1.000
84 48 158 1.000
85 48 159 1.000
86 48 160 1.000
87 48 161 1.000
88 49 50 1.000
89 49 51 1.000
90 49 61 1.000
91 49 69 1.000
92 49 70 1.000
93 49 71 1.000
94 50 51 1.000
95 50 82 1.000
96 51 52 1.000
97 51 53 1.000
98 51 54 1.000
99 51 71 1.000
100 51 80 1.000
101 51 81 1.000
102 51 82 1.000
103 52 53 1.000
104 52 81 1.000
105 52 82 1.000
106 52 83 1.000
107 53 54 1.000
108 53 80 1.000
109 53 81 1.000
110 53 83 1.000
111 54 55 1.000
112 54 56 1.000
113 54 59 1.000
114 54 78 1.000
115 54 79 1.000
116 54 80 1.000
117 54 81 1.000
118 55 56 1.000
119 55 57 1.000
120 55 77 1.000
121 55 78 1.000
122 55 79 1.000
123 55 113 1.000
124 56 57 1.000
125 56 58 1.000
126 56 59 1.000
127 56 74 1.000
128 56 75 1.000
129 56 78 1.000
130 56 79 1.000
131 57 58 1.000
132 57 59 1.000
133 58 59 1.000
134 58 60 1.000
135 58 73 1.000
136 58 75 1.000
137 59 60 1.000
138 59 71 1.000
139 59 72 1.000
140 59 73 1.000
141 59 74 1.000
142 59 78 1.000
143 59 80 1.000
144 60 61 1.000
145 60 62 1.000
146 60 71 1.000
147 60 72 1.000
148 60 73 1.000
149 61 62 1.000
150 61 69 1.000
151 61 70 1.000
152 61 71 1.000
153 61 72 1.000
154 62 63 1.000
155 62 64 1.000
156 62 69 1.000
157 62 70 1.000
158 62 72 1.000
159 63 64 1.000
160 63 65 1.000
161 63 67 1.000
162 63 68 1.000
163 63 69 1.000
164 64 65 1.000
165 64 66 1.000
166 64 67 1.000
167 64 68 1.000
168 64 69 1.000
169 64 70 1.000
170 64 132 1.000
171 64 159 1.000
172 65 66 1.000
173 65 67 1.000
174 65 130 1.000
175 66 67 1.000
176 66 68 1.000
177 67 68 1.000
178 67 69 1.000
179 68 69 1.000
180 68 70 1.000
181 68 159 1.000
182 69 70 1.000
183 69 71 1.000
184 69 159 1.000
185 70 71 1.000
186 70 72 1.000
187 70 99 1.000
188 70 132 1.000
189 70 157 1.000
190 70 158 1.000
191 70 159 1.000
192 71 72 1.000
193 71 74 1.000
194 71 80 1.000
195 71 157 1.000
196 71 158 1.000
197 72 73 1.000
198 72 74 1.000
199 72 155 1.000
200 72 156 1.000
201 72 157 1.000
202 72 158 1.000
203 73 74 1.000
204 73 75 1.000
205 74 75 1.000
206 74 78 1.000
207 74 152 1.000
208 74 154 1.000
209 74 155 1.000
210 74 156 1.000
211 74 157 1.000
212 74 158 1.000
213 75 76 1.000
214 75 77 1.000
215 75 78 1.000
216 75 152 1.000
217 75 154 1.000
218 75 155 1.000
219 76 77 1.000
220 76 78 1.000
221 76 152 1.000
222 76 153 1.000
223 76 154 1.000
224 77 78 1.000
225 77 79 1.000
226 77 113 1.000
227 77 151 1.000
228 77 152 1.000
229 77 153 1.000
230 77 154 1.000
231 78 79 1.000
232 78 80 1.000
233 78 151 1.000
234 78 152 1.000
235 78 154 1.000
236 79 80 1.000
237 79 81 1.000
238 79 113 1.000
239 79 149 1.000
240 79 150 1.000
241 79 151 1.000
242 79 152 1.000
243 80 81 1.000
244 80 82 1.000
245 80 149 1.000
246 80 150 1.000
247 81 82 1.000
248 81 83 1.000
249 81 111 1.000
250 81 112 1.000
251 81 113 1.000
252 81 147 1.000
253 81 148 1.000
254 81 149 1.000
255 81 150 1.000
256 82 83 1.000
257 82 85 1.000
258 82 147 1.000
259 82 148 1.000
260 82 149 1.000
261 82 150 1.000
262 83 84 1.000
263 83 85 1.000
264 83 147 1.000
265 84 85 1.000
266 84 86 1.000
267 84 145 1.000
268 84 146 1.000
269 84 147 1.000
270 85 86 1.000
271 85 87 1.000
272 85 145 1.000
273 85 146 1.000
274 85 147 1.000
275 85 148 1.000
276 86 87 1.000
277 86 88 1.000
278 86 144 1.000
279 86 145 1.000
280 87 88 1.000
281 87 89 1.000
282 87 90 1.000
283 87 91 1.000
284 87 142 1.000
285 87 143 1.000
286 87 144 1.000
287 87 145 1.000
288 87 146 1.000
289 87 163 1.000
290 88 89 1.000
291 88 90 1.000
292 88 143 1.000
293 88 144 1.000
294 88 145 1.000
295 89 90 1.000
296 89 143 1.000
297 89 144 1.000
298 90 91 1.000
299 90 92 1.000
300 90 141 1.000
301 90 142 1.000
302 90 143 1.000
303 90 144 1.000
304 90 165 1.000
305 91 92 1.000
306 91 93 1.000
307 91 94 1.000
308 91 139 1.000
309 91 141 1.000
310 91 142 1.000
311 91 143 1.000
312 91 163 1.000
313 91 164 1.000
314 91 165 1.000
315 92 93 1.000
316 92 138 1.000
317 92 139 1.000
318 92 140 1.000
319 92 141 1.000
320 92 142 1.000
321 92 164 1.000
322 92 165 1.000
323 92 166 1.000
324 93 94 1.000
325 93 95 1.000
326 93 136 1.000
327 93 137 1.000
328 93 138 1.000
329 93 139 1.000
330 93 163 1.000
331 93 164 1.000
332 93 165 1.000
333 93 166 1.000
334 94 95 1.000
335 94 96 1.000
336 94 108 1.000
337 94 119 1.000
338 94 121 1.000
339 94 136 1.000
340 94 137 1.000
341 94 139 1.000
342 94 161 1.000
343 94 162 1.000
344 94 163 1.000
345 94 164 1.000
346 95 96 1.000
347 95 97 1.000
348 95 134 1.000
349 95 135 1.000
350 95 136 1.000
351 95 161 1.000
352 95 162 1.000
353 95 163 1.000
354 95 164 1.000
355 96 97 1.000
356 96 98 1.000
357 96 106 1.000
358 96 121 1.000
359 96 123 1.000
360 96 134 1.000
361 96 135 1.000
362 96 136 1.000
363 96 158 1.000
364 96 160 1.000
365 96 161 1.000
366 96 162 1.000
367 97 98 1.000
368 97 132 1.000
369 97 133 1.000
370 97 134 1.000
371 97 158 1.000
372 97 159 1.000
373 97 160 1.000
374 97 161 1.000
375 98 99 1.000
376 98 100 1.000
377 98 106 1.000
378 98 121 1.000
379 98 123 1.000
380 98 126 1.000
381 98 132 1.000
382 98 133 1.000
383 98 134 1.000
384 98 135 1.000
385 98 156 1.000
386 98 157 1.000
387 98 158 1.000
388 98 159 1.000
389 99 100 1.000
390 99 126 1.000
391 99 128 1.000
392 99 129 1.000
393 99 130 1.000
394 99 131 1.000
395 99 132 1.000
396 99 133 1.000
397 99 156 1.000
398 99 157 1.000
399 99 159 1.000
400 100 101 1.000
401 100 102 1.000
402 100 103 1.000
403 100 104 1.000
404 100 123 1.000
405 100 124 1.000
406 100 125 1.000
407 100 126 1.000
408 100 127 1.000
409 100 129 1.000
410 100 155 1.000
411 100 156 1.000
412 100 157 1.000
413 101 102 1.000
414 101 125 1.000
415 101 126 1.000
416 101 127 1.000
417 101 128 1.000
418 101 129 1.000
419 101 155 1.000
420 102 103 1.000
421 102 104 1.000
422 102 124 1.000
423 102 125 1.000
424 102 155 1.000
425 103 104 1.000
426 103 122 1.000
427 103 123 1.000
428 103 124 1.000
429 103 125 1.000
430 104 105 1.000
431 104 106 1.000
432 104 123 1.000
433 104 124 1.000
434 104 152 1.000
435 104 153 1.000
436 104 154 1.000
437 104 155 1.000
438 104 156 1.000
439 105 106 1.000
440 105 107 1.000
441 105 120 1.000
442 105 121 1.000
443 105 122 1.000
444 105 123 1.000
445 105 153 1.000
446 106 107 1.000
447 106 108 1.000
448 106 120 1.000
449 106 121 1.000
450 106 123 1.000
451 106 150 1.000
452 106 151 1.000
453 106 152 1.000
454 106 153 1.000
455 106 156 1.000
456 106 158 1.000
457 107 108 1.000
458 107 109 1.000
459 107 117 1.000
460 107 119 1.000
461 107 120 1.000
462 107 121 1.000
463 107 149 1.000
464 107 150 1.000
465 107 151 1.000
466 107 152 1.000
467 107 153 1.000
468 108 109 1.000
469 108 117 1.000
470 108 118 1.000
471 108 119 1.000
472 108 120 1.000
473 108 121 1.000
474 108 137 1.000
475 108 139 1.000
476 108 148 1.000
477 108 149 1.000
478 108 150 1.000
479 109 110 1.000
480 109 111 1.000
481 109 112 1.000
482 109 113 1.000
483 109 114 1.000
484 109 115 1.000
485 109 116 1.000
486 109 117 1.000
487 109 118 1.000
488 109 148 1.000
489 109 149 1.000
490 109 150 1.000
491 109 151 1.000
492 110 111 1.000
493 110 112 1.000
494 110 115 1.000
495 110 116 1.000
496 110 118 1.000
497 110 142 1.000
498 110 146 1.000
499 110 147 1.000
500 110 148 1.000
501 110 149 1.000
502 111 112 1.000
503 111 115 1.000
504 111 116 1.000
505 111 146 1.000
506 111 147 1.000
507 111 148 1.000
508 111 149 1.000
509 112 113 1.000
510 112 114 1.000
511 112 115 1.000
512 112 147 1.000
513 112 149 1.000
514 113 114 1.000
515 113 115 1.000
516 113 149 1.000
517 113 151 1.000
518 114 115 1.000
519 115 116 1.000
520 115 117 1.000
521 115 149 1.000
522 116 117 1.000
523 116 118 1.000
524 116 140 1.000
525 117 118 1.000
526 117 119 1.000
527 117 120 1.000
528 118 119 1.000
529 118 139 1.000
530 118 140 1.000
531 118 142 1.000
532 118 148 1.000
533 119 120 1.000
534 119 121 1.000
535 119 137 1.000
536 119 138 1.000
537 119 139 1.000
538 119 140 1.000
539 120 121 1.000
540 120 122 1.000
541 120 137 1.000
542 121 122 1.000
543 121 123 1.000
544 121 135 1.000
545 121 136 1.000
546 121 137 1.000
547 122 123 1.000
548 122 124 1.000
549 122 135 1.000
550 122 137 1.000
551 123 124 1.000
552 123 126 1.000
553 123 135 1.000
554 123 156 1.000
555 124 125 1.000
556 124 126 1.000
557 124 135 1.000
558 125 126 1.000
559 125 127 1.000
560 126 127 1.000
561 126 128 1.000
562 126 131 1.000
563 126 132 1.000
564 126 133 1.000
565 127 128 1.000
566 127 131 1.000
567 128 129 1.000
568 128 130 1.000
569 128 131 1.000
570 129 130 1.000
571 129 131 1.000
572 129 155 1.000
573 129 157 1.000
574 130 131 1.000
575 130 132 1.000
576 131 132 1.000
577 131 133 1.000
578 132 133 1.000
579 132 134 1.000
580 132 157 1.000
581 132 159 1.000
582 133 134 1.000
583 133 135 1.000
584 134 135 1.000
585 134 136 1.000
586 135 136 1.000
587 135 137 1.000
588 136 137 1.000
589 137 138 1.000
590 137 139 1.000
591 138 139 1.000
592 138 166 1.000
593 139 140 1.000
594 139 141 1.000
595 139 142 1.000
596 139 163 1.000
597 140 141 1.000
598 140 142 1.000
599 141 142 1.000
600 141 143 1.000
601 142 143 1.000
602 142 144 1.000
603 142 146 1.000
604 142 163 1.000
605 143 144 1.000
606 143 146 1.000
607 144 145 1.000
608 144 146 1.000
609 145 146 1.000
610 146 147 1.000
611 146 148 1.000
612 147 148 1.000
613 147 149 1.000
614 148 149 1.000
615 148 150 1.000
616 149 150 1.000
617 149 151 1.000
618 150 151 1.000
619 150 152 1.000
620 150 158 1.000
621 150 161 1.000
622 151 152 1.000
623 151 153 1.000
624 152 153 1.000
625 152 154 1.000
626 152 156 1.000
627 153 154 1.000
628 154 155 1.000
629 154 156 1.000
630 155 156 1.000
631 156 157 1.000
632 156 158 1.000
633 157 158 1.000
634 157 159 1.000
635 158 159 1.000
636 158 160 1.000
637 158 161 1.000
638 159 160 1.000
639 160 161 1.000
640 160 162 1.000
641 161 162 1.000
642 161 163 1.000
643 162 163 1.000
644 162 164 1.000
645 163 164 1.000
646 164 165 1.000
647 164 166 1.000
648 165 166 1.000