ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1od3A_SC_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (11 years, 2 months ago) by duarte
File size: 3780 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line User Rev File contents
1 duarte 884 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: MGSSHHHHHHSSGLVPRGSHMASTPANVNSGPTSPVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSKSGT
3     #PDB: 1od3
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: SC
8     #CUTOFF: 5.0
9     39 84 1.000
10     39 86 1.000
11     39 145 1.000
12     40 46 1.000
13     40 50 1.000
14     40 52 1.000
15     40 82 1.000
16     40 83 1.000
17     40 85 1.000
18     41 43 1.000
19     41 44 1.000
20     42 43 1.000
21     42 85 1.000
22     42 87 1.000
23     42 163 1.000
24     43 91 1.000
25     43 165 1.000
26     45 47 1.000
27     45 160 1.000
28     45 162 1.000
29     46 82 1.000
30     46 85 1.000
31     46 161 1.000
32     46 163 1.000
33     47 49 1.000
34     47 50 1.000
35     47 159 1.000
36     47 160 1.000
37     48 49 1.000
38     48 71 1.000
39     48 82 1.000
40     48 158 1.000
41     48 161 1.000
42     49 50 1.000
43     49 61 1.000
44     49 69 1.000
45     49 71 1.000
46     49 159 1.000
47     51 54 1.000
48     51 59 1.000
49     51 61 1.000
50     51 71 1.000
51     51 80 1.000
52     51 82 1.000
53     52 53 1.000
54     52 82 1.000
55     52 83 1.000
56     53 81 1.000
57     54 80 1.000
58     55 57 1.000
59     55 78 1.000
60     55 79 1.000
61     57 58 1.000
62     57 78 1.000
63     58 73 1.000
64     58 75 1.000
65     58 78 1.000
66     59 61 1.000
67     59 71 1.000
68     59 74 1.000
69     59 78 1.000
70     59 80 1.000
71     60 62 1.000
72     60 73 1.000
73     61 69 1.000
74     61 71 1.000
75     62 64 1.000
76     62 70 1.000
77     62 73 1.000
78     62 132 1.000
79     62 157 1.000
80     63 69 1.000
81     64 65 1.000
82     64 70 1.000
83     64 132 1.000
84     64 159 1.000
85     70 132 1.000
86     70 157 1.000
87     70 159 1.000
88     71 74 1.000
89     71 80 1.000
90     71 82 1.000
91     71 152 1.000
92     71 158 1.000
93     74 78 1.000
94     74 152 1.000
95     74 156 1.000
96     74 158 1.000
97     75 78 1.000
98     75 155 1.000
99     76 153 1.000
100     78 152 1.000
101     79 113 1.000
102     79 149 1.000
103     79 151 1.000
104     80 82 1.000
105     80 150 1.000
106     80 152 1.000
107     81 83 1.000
108     81 113 1.000
109     81 147 1.000
110     81 149 1.000
111     82 85 1.000
112     82 148 1.000
113     82 150 1.000
114     82 161 1.000
115     83 84 1.000
116     83 147 1.000
117     84 145 1.000
118     84 147 1.000
119     85 87 1.000
120     85 148 1.000
121     85 163 1.000
122     86 145 1.000
123     87 91 1.000
124     87 139 1.000
125     87 142 1.000
126     87 143 1.000
127     87 146 1.000
128     87 148 1.000
129     87 163 1.000
130     89 165 1.000
131     91 139 1.000
132     91 163 1.000
133     92 93 1.000
134     92 141 1.000
135     92 165 1.000
136     92 166 1.000
137     93 95 1.000
138     93 136 1.000
139     93 164 1.000
140     93 166 1.000
141     94 108 1.000
142     94 121 1.000
143     94 137 1.000
144     94 139 1.000
145     94 161 1.000
146     94 163 1.000
147     95 134 1.000
148     95 136 1.000
149     95 160 1.000
150     95 162 1.000
151     96 98 1.000
152     96 121 1.000
153     96 135 1.000
154     96 158 1.000
155     96 161 1.000
156     97 132 1.000
157     97 133 1.000
158     97 134 1.000
159     97 159 1.000
160     97 160 1.000
161     98 106 1.000
162     98 123 1.000
163     98 135 1.000
164     98 156 1.000
165     98 158 1.000
166     99 126 1.000
167     99 132 1.000
168     99 157 1.000
169     100 101 1.000
170     100 104 1.000
171     100 123 1.000
172     100 129 1.000
173     100 155 1.000
174     100 156 1.000
175     101 102 1.000
176     101 125 1.000
177     101 128 1.000
178     101 129 1.000
179     104 105 1.000
180     104 123 1.000
181     104 153 1.000
182     104 156 1.000
183     105 120 1.000
184     105 122 1.000
185     105 153 1.000
186     106 121 1.000
187     106 123 1.000
188     106 150 1.000
189     106 152 1.000
190     106 156 1.000
191     106 158 1.000
192     107 109 1.000
193     107 117 1.000
194     107 120 1.000
195     107 151 1.000
196     108 118 1.000
197     108 121 1.000
198     108 139 1.000
199     108 148 1.000
200     108 150 1.000
201     108 163 1.000
202     109 114 1.000
203     109 117 1.000
204     109 149 1.000
205     109 151 1.000
206     110 116 1.000
207     110 118 1.000
208     110 146 1.000
209     110 148 1.000
210     112 113 1.000
211     112 114 1.000
212     113 149 1.000
213     113 151 1.000
214     116 118 1.000
215     117 120 1.000
216     118 139 1.000
217     118 140 1.000
218     118 142 1.000
219     118 148 1.000
220     120 122 1.000
221     121 123 1.000
222     121 135 1.000
223     121 137 1.000
224     123 135 1.000
225     123 156 1.000
226     126 131 1.000
227     126 133 1.000
228     128 129 1.000
229     128 130 1.000
230     128 131 1.000
231     129 130 1.000
232     129 155 1.000
233     129 157 1.000
234     131 133 1.000
235     132 157 1.000
236     132 159 1.000
237     134 160 1.000
238     138 166 1.000
239     139 142 1.000
240     139 163 1.000
241     141 143 1.000
242     142 146 1.000
243     142 148 1.000
244     146 148 1.000
245     148 150 1.000
246     148 161 1.000
247     148 163 1.000
248     149 151 1.000
249     150 152 1.000
250     150 158 1.000
251     150 161 1.000
252     152 156 1.000
253     152 158 1.000
254     156 158 1.000
255     159 160 1.000
256     160 162 1.000
257     161 163 1.000