ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1od3A_SC_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 3780 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: MGSSHHHHHHSSGLVPRGSHMASTPANVNSGPTSPVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSKSGT
3 #PDB: 1od3
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: SC
8 #CUTOFF: 5.0
9 39 84 1.000
10 39 86 1.000
11 39 145 1.000
12 40 46 1.000
13 40 50 1.000
14 40 52 1.000
15 40 82 1.000
16 40 83 1.000
17 40 85 1.000
18 41 43 1.000
19 41 44 1.000
20 42 43 1.000
21 42 85 1.000
22 42 87 1.000
23 42 163 1.000
24 43 91 1.000
25 43 165 1.000
26 45 47 1.000
27 45 160 1.000
28 45 162 1.000
29 46 82 1.000
30 46 85 1.000
31 46 161 1.000
32 46 163 1.000
33 47 49 1.000
34 47 50 1.000
35 47 159 1.000
36 47 160 1.000
37 48 49 1.000
38 48 71 1.000
39 48 82 1.000
40 48 158 1.000
41 48 161 1.000
42 49 50 1.000
43 49 61 1.000
44 49 69 1.000
45 49 71 1.000
46 49 159 1.000
47 51 54 1.000
48 51 59 1.000
49 51 61 1.000
50 51 71 1.000
51 51 80 1.000
52 51 82 1.000
53 52 53 1.000
54 52 82 1.000
55 52 83 1.000
56 53 81 1.000
57 54 80 1.000
58 55 57 1.000
59 55 78 1.000
60 55 79 1.000
61 57 58 1.000
62 57 78 1.000
63 58 73 1.000
64 58 75 1.000
65 58 78 1.000
66 59 61 1.000
67 59 71 1.000
68 59 74 1.000
69 59 78 1.000
70 59 80 1.000
71 60 62 1.000
72 60 73 1.000
73 61 69 1.000
74 61 71 1.000
75 62 64 1.000
76 62 70 1.000
77 62 73 1.000
78 62 132 1.000
79 62 157 1.000
80 63 69 1.000
81 64 65 1.000
82 64 70 1.000
83 64 132 1.000
84 64 159 1.000
85 70 132 1.000
86 70 157 1.000
87 70 159 1.000
88 71 74 1.000
89 71 80 1.000
90 71 82 1.000
91 71 152 1.000
92 71 158 1.000
93 74 78 1.000
94 74 152 1.000
95 74 156 1.000
96 74 158 1.000
97 75 78 1.000
98 75 155 1.000
99 76 153 1.000
100 78 152 1.000
101 79 113 1.000
102 79 149 1.000
103 79 151 1.000
104 80 82 1.000
105 80 150 1.000
106 80 152 1.000
107 81 83 1.000
108 81 113 1.000
109 81 147 1.000
110 81 149 1.000
111 82 85 1.000
112 82 148 1.000
113 82 150 1.000
114 82 161 1.000
115 83 84 1.000
116 83 147 1.000
117 84 145 1.000
118 84 147 1.000
119 85 87 1.000
120 85 148 1.000
121 85 163 1.000
122 86 145 1.000
123 87 91 1.000
124 87 139 1.000
125 87 142 1.000
126 87 143 1.000
127 87 146 1.000
128 87 148 1.000
129 87 163 1.000
130 89 165 1.000
131 91 139 1.000
132 91 163 1.000
133 92 93 1.000
134 92 141 1.000
135 92 165 1.000
136 92 166 1.000
137 93 95 1.000
138 93 136 1.000
139 93 164 1.000
140 93 166 1.000
141 94 108 1.000
142 94 121 1.000
143 94 137 1.000
144 94 139 1.000
145 94 161 1.000
146 94 163 1.000
147 95 134 1.000
148 95 136 1.000
149 95 160 1.000
150 95 162 1.000
151 96 98 1.000
152 96 121 1.000
153 96 135 1.000
154 96 158 1.000
155 96 161 1.000
156 97 132 1.000
157 97 133 1.000
158 97 134 1.000
159 97 159 1.000
160 97 160 1.000
161 98 106 1.000
162 98 123 1.000
163 98 135 1.000
164 98 156 1.000
165 98 158 1.000
166 99 126 1.000
167 99 132 1.000
168 99 157 1.000
169 100 101 1.000
170 100 104 1.000
171 100 123 1.000
172 100 129 1.000
173 100 155 1.000
174 100 156 1.000
175 101 102 1.000
176 101 125 1.000
177 101 128 1.000
178 101 129 1.000
179 104 105 1.000
180 104 123 1.000
181 104 153 1.000
182 104 156 1.000
183 105 120 1.000
184 105 122 1.000
185 105 153 1.000
186 106 121 1.000
187 106 123 1.000
188 106 150 1.000
189 106 152 1.000
190 106 156 1.000
191 106 158 1.000
192 107 109 1.000
193 107 117 1.000
194 107 120 1.000
195 107 151 1.000
196 108 118 1.000
197 108 121 1.000
198 108 139 1.000
199 108 148 1.000
200 108 150 1.000
201 108 163 1.000
202 109 114 1.000
203 109 117 1.000
204 109 149 1.000
205 109 151 1.000
206 110 116 1.000
207 110 118 1.000
208 110 146 1.000
209 110 148 1.000
210 112 113 1.000
211 112 114 1.000
212 113 149 1.000
213 113 151 1.000
214 116 118 1.000
215 117 120 1.000
216 118 139 1.000
217 118 140 1.000
218 118 142 1.000
219 118 148 1.000
220 120 122 1.000
221 121 123 1.000
222 121 135 1.000
223 121 137 1.000
224 123 135 1.000
225 123 156 1.000
226 126 131 1.000
227 126 133 1.000
228 128 129 1.000
229 128 130 1.000
230 128 131 1.000
231 129 130 1.000
232 129 155 1.000
233 129 157 1.000
234 131 133 1.000
235 132 157 1.000
236 132 159 1.000
237 134 160 1.000
238 138 166 1.000
239 139 142 1.000
240 139 163 1.000
241 141 143 1.000
242 142 146 1.000
243 142 148 1.000
244 146 148 1.000
245 148 150 1.000
246 148 161 1.000
247 148 163 1.000
248 149 151 1.000
249 150 152 1.000
250 150 158 1.000
251 150 161 1.000
252 152 156 1.000
253 152 158 1.000
254 156 158 1.000
255 159 160 1.000
256 160 162 1.000
257 161 163 1.000