ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1oewA_ALL_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 26269 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: STGSATTTPIDSLDDAYITPVQIGTPAQTLNLDFDTGSSDLWVFSSETTASEVXQTIYTPSKSTTAKLLSGATWSISYGDGSSSSGDVYTDTVSVGGLTVTGQAVESAKKVSSSFTEDSTIDGLLGLAFSTLNTVSPTQQKTFFDNAKASLDSPVFTADLGYHAPGTYNFGFIDTTAYTGSITYTAVSTKQGFWEWTSTGYAVGSGTFKSTSIDGIADTGTTLLYLPATVVSAYWAQVSGAKSSSSVGGYVFPCSATLPSFTFGVGSARIVIPGDYIDFGPISTGSSSCFGGIQSSAGIGINIFGDVALKAAFVVFNGATTPTLGFASK
3 #PDB: 1oew
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: ALL
8 #CUTOFF: 5.0
9 1 2 1.000
10 1 3 1.000
11 1 98 1.000
12 1 150 1.000
13 1 151 1.000
14 1 152 1.000
15 1 170 1.000
16 1 171 1.000
17 2 3 1.000
18 2 4 1.000
19 2 96 1.000
20 2 97 1.000
21 2 98 1.000
22 2 151 1.000
23 2 152 1.000
24 2 170 1.000
25 2 171 1.000
26 2 172 1.000
27 3 4 1.000
28 3 5 1.000
29 3 95 1.000
30 3 96 1.000
31 3 97 1.000
32 3 98 1.000
33 3 168 1.000
34 3 169 1.000
35 3 170 1.000
36 3 172 1.000
37 4 5 1.000
38 4 6 1.000
39 4 95 1.000
40 4 96 1.000
41 4 97 1.000
42 4 167 1.000
43 4 168 1.000
44 4 169 1.000
45 4 170 1.000
46 4 172 1.000
47 5 6 1.000
48 5 7 1.000
49 5 19 1.000
50 5 20 1.000
51 5 95 1.000
52 5 96 1.000
53 5 166 1.000
54 5 167 1.000
55 5 168 1.000
56 5 169 1.000
57 6 7 1.000
58 6 8 1.000
59 6 18 1.000
60 6 19 1.000
61 6 20 1.000
62 6 165 1.000
63 6 166 1.000
64 6 167 1.000
65 7 8 1.000
66 7 9 1.000
67 7 17 1.000
68 7 18 1.000
69 7 19 1.000
70 7 159 1.000
71 7 160 1.000
72 7 164 1.000
73 7 165 1.000
74 7 166 1.000
75 7 167 1.000
76 7 168 1.000
77 8 9 1.000
78 8 10 1.000
79 8 16 1.000
80 8 17 1.000
81 8 18 1.000
82 8 165 1.000
83 9 10 1.000
84 9 11 1.000
85 9 14 1.000
86 9 16 1.000
87 9 17 1.000
88 9 18 1.000
89 9 161 1.000
90 9 163 1.000
91 9 164 1.000
92 9 165 1.000
93 10 11 1.000
94 10 12 1.000
95 10 15 1.000
96 10 16 1.000
97 10 17 1.000
98 10 18 1.000
99 10 118 1.000
100 10 120 1.000
101 10 121 1.000
102 11 12 1.000
103 11 13 1.000
104 11 14 1.000
105 11 15 1.000
106 11 16 1.000
107 12 13 1.000
108 12 14 1.000
109 12 163 1.000
110 13 14 1.000
111 13 15 1.000
112 13 163 1.000
113 13 279 1.000
114 13 280 1.000
115 13 281 1.000
116 13 310 1.000
117 14 15 1.000
118 14 16 1.000
119 14 17 1.000
120 14 161 1.000
121 14 162 1.000
122 14 163 1.000
123 14 164 1.000
124 14 222 1.000
125 14 279 1.000
126 14 306 1.000
127 14 310 1.000
128 15 16 1.000
129 15 17 1.000
130 15 222 1.000
131 15 279 1.000
132 15 306 1.000
133 16 17 1.000
134 16 18 1.000
135 16 33 1.000
136 16 121 1.000
137 16 222 1.000
138 16 306 1.000
139 17 18 1.000
140 17 19 1.000
141 17 32 1.000
142 17 33 1.000
143 17 34 1.000
144 17 160 1.000
145 17 161 1.000
146 17 162 1.000
147 17 163 1.000
148 17 164 1.000
149 17 306 1.000
150 17 310 1.000
151 18 19 1.000
152 18 20 1.000
153 18 31 1.000
154 18 32 1.000
155 18 33 1.000
156 18 120 1.000
157 18 121 1.000
158 19 20 1.000
159 19 21 1.000
160 19 30 1.000
161 19 31 1.000
162 19 32 1.000
163 19 34 1.000
164 19 95 1.000
165 19 168 1.000
166 20 21 1.000
167 20 22 1.000
168 20 29 1.000
169 20 30 1.000
170 20 31 1.000
171 20 32 1.000
172 20 34 1.000
173 20 94 1.000
174 20 95 1.000
175 20 96 1.000
176 21 22 1.000
177 21 23 1.000
178 21 28 1.000
179 21 29 1.000
180 21 30 1.000
181 21 31 1.000
182 21 32 1.000
183 21 34 1.000
184 21 93 1.000
185 21 94 1.000
186 21 95 1.000
187 21 125 1.000
188 22 23 1.000
189 22 24 1.000
190 22 27 1.000
191 22 28 1.000
192 22 29 1.000
193 22 92 1.000
194 22 93 1.000
195 22 94 1.000
196 22 95 1.000
197 22 96 1.000
198 23 24 1.000
199 23 25 1.000
200 23 26 1.000
201 23 27 1.000
202 23 28 1.000
203 23 29 1.000
204 23 30 1.000
205 23 32 1.000
206 23 41 1.000
207 23 43 1.000
208 23 58 1.000
209 23 91 1.000
210 23 92 1.000
211 23 93 1.000
212 23 105 1.000
213 24 25 1.000
214 24 26 1.000
215 24 27 1.000
216 24 28 1.000
217 24 58 1.000
218 24 63 1.000
219 24 65 1.000
220 24 91 1.000
221 24 92 1.000
222 25 26 1.000
223 25 27 1.000
224 25 62 1.000
225 25 63 1.000
226 25 64 1.000
227 25 65 1.000
228 25 91 1.000
229 25 92 1.000
230 26 27 1.000
231 26 28 1.000
232 26 62 1.000
233 27 28 1.000
234 27 29 1.000
235 28 29 1.000
236 28 30 1.000
237 28 57 1.000
238 28 58 1.000
239 28 59 1.000
240 28 60 1.000
241 28 62 1.000
242 28 63 1.000
243 29 30 1.000
244 29 31 1.000
245 29 56 1.000
246 30 31 1.000
247 30 32 1.000
248 30 43 1.000
249 30 44 1.000
250 30 56 1.000
251 30 57 1.000
252 30 58 1.000
253 30 122 1.000
254 31 32 1.000
255 31 33 1.000
256 31 120 1.000
257 31 121 1.000
258 31 122 1.000
259 31 123 1.000
260 32 33 1.000
261 32 34 1.000
262 32 41 1.000
263 32 42 1.000
264 32 43 1.000
265 32 122 1.000
266 32 123 1.000
267 32 124 1.000
268 32 125 1.000
269 33 34 1.000
270 33 35 1.000
271 33 121 1.000
272 33 123 1.000
273 33 124 1.000
274 33 125 1.000
275 33 219 1.000
276 33 220 1.000
277 34 35 1.000
278 34 36 1.000
279 34 95 1.000
280 34 125 1.000
281 34 127 1.000
282 34 168 1.000
283 34 170 1.000
284 34 219 1.000
285 34 220 1.000
286 35 36 1.000
287 35 37 1.000
288 35 38 1.000
289 35 78 1.000
290 35 124 1.000
291 35 125 1.000
292 35 126 1.000
293 35 127 1.000
294 35 128 1.000
295 35 218 1.000
296 35 219 1.000
297 35 220 1.000
298 35 221 1.000
299 36 37 1.000
300 36 38 1.000
301 36 127 1.000
302 36 128 1.000
303 36 156 1.000
304 36 194 1.000
305 36 217 1.000
306 36 218 1.000
307 36 219 1.000
308 36 220 1.000
309 36 316 1.000
310 37 38 1.000
311 37 39 1.000
312 37 128 1.000
313 37 132 1.000
314 37 193 1.000
315 37 216 1.000
316 37 217 1.000
317 37 218 1.000
318 37 219 1.000
319 37 220 1.000
320 38 39 1.000
321 38 40 1.000
322 38 76 1.000
323 38 78 1.000
324 38 124 1.000
325 38 126 1.000
326 38 127 1.000
327 38 128 1.000
328 39 40 1.000
329 39 41 1.000
330 39 106 1.000
331 39 126 1.000
332 39 127 1.000
333 39 128 1.000
334 39 129 1.000
335 39 130 1.000
336 39 132 1.000
337 39 133 1.000
338 39 140 1.000
339 39 142 1.000
340 39 192 1.000
341 40 41 1.000
342 40 42 1.000
343 40 74 1.000
344 40 76 1.000
345 40 78 1.000
346 40 106 1.000
347 40 124 1.000
348 40 125 1.000
349 40 126 1.000
350 40 132 1.000
351 40 133 1.000
352 40 134 1.000
353 40 135 1.000
354 41 42 1.000
355 41 43 1.000
356 41 93 1.000
357 41 103 1.000
358 41 104 1.000
359 41 105 1.000
360 41 106 1.000
361 41 124 1.000
362 41 125 1.000
363 41 126 1.000
364 41 143 1.000
365 42 43 1.000
366 42 44 1.000
367 42 74 1.000
368 42 76 1.000
369 42 78 1.000
370 42 84 1.000
371 42 106 1.000
372 42 108 1.000
373 42 111 1.000
374 42 115 1.000
375 42 122 1.000
376 42 123 1.000
377 42 124 1.000
378 43 44 1.000
379 43 45 1.000
380 43 48 1.000
381 43 58 1.000
382 43 105 1.000
383 43 106 1.000
384 43 107 1.000
385 43 108 1.000
386 43 122 1.000
387 43 123 1.000
388 44 45 1.000
389 44 46 1.000
390 44 48 1.000
391 44 52 1.000
392 44 53 1.000
393 44 55 1.000
394 44 56 1.000
395 44 57 1.000
396 44 58 1.000
397 44 108 1.000
398 44 111 1.000
399 44 115 1.000
400 44 116 1.000
401 44 121 1.000
402 44 122 1.000
403 44 123 1.000
404 45 46 1.000
405 45 47 1.000
406 45 48 1.000
407 45 53 1.000
408 45 57 1.000
409 45 58 1.000
410 45 60 1.000
411 45 107 1.000
412 45 108 1.000
413 46 47 1.000
414 46 48 1.000
415 46 57 1.000
416 46 58 1.000
417 46 59 1.000
418 46 60 1.000
419 47 48 1.000
420 47 49 1.000
421 47 60 1.000
422 47 87 1.000
423 47 89 1.000
424 47 107 1.000
425 47 108 1.000
426 47 109 1.000
427 48 49 1.000
428 48 50 1.000
429 48 52 1.000
430 48 53 1.000
431 48 108 1.000
432 48 109 1.000
433 48 110 1.000
434 48 111 1.000
435 49 50 1.000
436 49 51 1.000
437 49 52 1.000
438 49 53 1.000
439 49 109 1.000
440 49 110 1.000
441 50 51 1.000
442 50 52 1.000
443 50 53 1.000
444 51 52 1.000
445 51 53 1.000
446 51 116 1.000
447 52 53 1.000
448 52 55 1.000
449 52 109 1.000
450 52 110 1.000
451 52 111 1.000
452 52 116 1.000
453 53 55 1.000
454 53 57 1.000
455 53 116 1.000
456 55 56 1.000
457 55 57 1.000
458 55 115 1.000
459 55 116 1.000
460 55 117 1.000
461 55 118 1.000
462 55 119 1.000
463 55 121 1.000
464 55 122 1.000
465 56 57 1.000
466 56 58 1.000
467 56 122 1.000
468 57 58 1.000
469 57 59 1.000
470 58 59 1.000
471 58 60 1.000
472 58 63 1.000
473 58 66 1.000
474 58 89 1.000
475 58 91 1.000
476 58 105 1.000
477 59 60 1.000
478 59 61 1.000
479 59 62 1.000
480 59 63 1.000
481 60 61 1.000
482 60 62 1.000
483 60 63 1.000
484 60 66 1.000
485 60 89 1.000
486 60 107 1.000
487 61 62 1.000
488 61 63 1.000
489 62 63 1.000
490 62 64 1.000
491 63 64 1.000
492 63 65 1.000
493 63 66 1.000
494 63 91 1.000
495 64 65 1.000
496 64 66 1.000
497 65 66 1.000
498 65 67 1.000
499 65 90 1.000
500 65 91 1.000
501 65 92 1.000
502 66 67 1.000
503 66 68 1.000
504 66 89 1.000
505 66 90 1.000
506 66 91 1.000
507 67 68 1.000
508 67 69 1.000
509 67 88 1.000
510 67 89 1.000
511 67 90 1.000
512 68 69 1.000
513 68 70 1.000
514 68 87 1.000
515 68 88 1.000
516 68 89 1.000
517 68 90 1.000
518 69 70 1.000
519 69 71 1.000
520 69 72 1.000
521 69 88 1.000
522 69 89 1.000
523 69 90 1.000
524 69 135 1.000
525 69 140 1.000
526 70 71 1.000
527 70 72 1.000
528 71 72 1.000
529 71 73 1.000
530 71 136 1.000
531 71 137 1.000
532 72 73 1.000
533 72 74 1.000
534 72 86 1.000
535 72 87 1.000
536 72 88 1.000
537 72 135 1.000
538 72 136 1.000
539 72 137 1.000
540 73 74 1.000
541 73 75 1.000
542 73 86 1.000
543 73 87 1.000
544 73 88 1.000
545 73 134 1.000
546 73 135 1.000
547 73 136 1.000
548 74 75 1.000
549 74 76 1.000
550 74 84 1.000
551 74 85 1.000
552 74 86 1.000
553 74 87 1.000
554 74 88 1.000
555 74 106 1.000
556 74 107 1.000
557 74 108 1.000
558 74 134 1.000
559 74 135 1.000
560 75 76 1.000
561 75 77 1.000
562 75 84 1.000
563 75 85 1.000
564 75 134 1.000
565 76 77 1.000
566 76 78 1.000
567 76 82 1.000
568 76 83 1.000
569 76 84 1.000
570 76 134 1.000
571 77 78 1.000
572 77 79 1.000
573 77 82 1.000
574 77 83 1.000
575 78 79 1.000
576 78 80 1.000
577 78 81 1.000
578 78 82 1.000
579 78 83 1.000
580 78 84 1.000
581 78 115 1.000
582 78 124 1.000
583 79 80 1.000
584 79 81 1.000
585 80 81 1.000
586 80 82 1.000
587 80 114 1.000
588 81 82 1.000
589 81 83 1.000
590 82 83 1.000
591 82 84 1.000
592 82 112 1.000
593 82 114 1.000
594 82 115 1.000
595 83 84 1.000
596 83 85 1.000
597 83 110 1.000
598 83 111 1.000
599 83 112 1.000
600 83 115 1.000
601 84 85 1.000
602 84 86 1.000
603 84 108 1.000
604 84 110 1.000
605 84 111 1.000
606 84 112 1.000
607 84 115 1.000
608 85 86 1.000
609 85 87 1.000
610 85 107 1.000
611 85 108 1.000
612 85 109 1.000
613 85 110 1.000
614 86 87 1.000
615 86 88 1.000
616 86 107 1.000
617 86 108 1.000
618 86 109 1.000
619 87 88 1.000
620 87 89 1.000
621 87 105 1.000
622 87 106 1.000
623 87 107 1.000
624 87 109 1.000
625 88 89 1.000
626 88 90 1.000
627 88 104 1.000
628 88 105 1.000
629 88 106 1.000
630 88 107 1.000
631 88 135 1.000
632 88 140 1.000
633 89 90 1.000
634 89 91 1.000
635 89 103 1.000
636 89 104 1.000
637 89 105 1.000
638 89 106 1.000
639 89 107 1.000
640 90 91 1.000
641 90 92 1.000
642 90 102 1.000
643 90 103 1.000
644 90 104 1.000
645 90 105 1.000
646 90 140 1.000
647 91 92 1.000
648 91 93 1.000
649 91 100 1.000
650 91 101 1.000
651 91 102 1.000
652 91 103 1.000
653 91 105 1.000
654 92 93 1.000
655 92 94 1.000
656 92 99 1.000
657 92 100 1.000
658 92 101 1.000
659 92 102 1.000
660 93 94 1.000
661 93 95 1.000
662 93 98 1.000
663 93 99 1.000
664 93 100 1.000
665 93 103 1.000
666 93 105 1.000
667 93 125 1.000
668 93 143 1.000
669 94 95 1.000
670 94 96 1.000
671 94 98 1.000
672 94 99 1.000
673 94 100 1.000
674 94 143 1.000
675 95 96 1.000
676 95 97 1.000
677 95 98 1.000
678 95 125 1.000
679 95 143 1.000
680 95 170 1.000
681 96 97 1.000
682 96 98 1.000
683 97 98 1.000
684 97 99 1.000
685 98 99 1.000
686 98 100 1.000
687 98 143 1.000
688 98 147 1.000
689 98 150 1.000
690 98 151 1.000
691 98 170 1.000
692 99 100 1.000
693 99 101 1.000
694 99 150 1.000
695 100 101 1.000
696 100 102 1.000
697 100 103 1.000
698 100 143 1.000
699 100 146 1.000
700 100 147 1.000
701 101 102 1.000
702 101 103 1.000
703 102 103 1.000
704 102 104 1.000
705 102 146 1.000
706 103 104 1.000
707 103 105 1.000
708 103 141 1.000
709 103 142 1.000
710 103 143 1.000
711 103 146 1.000
712 104 105 1.000
713 104 106 1.000
714 104 140 1.000
715 104 141 1.000
716 104 146 1.000
717 105 106 1.000
718 105 107 1.000
719 106 107 1.000
720 106 108 1.000
721 106 133 1.000
722 106 134 1.000
723 106 135 1.000
724 107 108 1.000
725 107 109 1.000
726 108 109 1.000
727 108 110 1.000
728 108 111 1.000
729 109 110 1.000
730 109 111 1.000
731 110 111 1.000
732 110 112 1.000
733 111 112 1.000
734 111 113 1.000
735 111 115 1.000
736 111 116 1.000
737 112 113 1.000
738 112 114 1.000
739 112 115 1.000
740 112 116 1.000
741 113 114 1.000
742 113 115 1.000
743 113 116 1.000
744 113 117 1.000
745 114 115 1.000
746 114 116 1.000
747 114 117 1.000
748 114 118 1.000
749 115 116 1.000
750 115 117 1.000
751 115 118 1.000
752 115 119 1.000
753 115 121 1.000
754 115 124 1.000
755 116 117 1.000
756 116 118 1.000
757 116 119 1.000
758 117 118 1.000
759 117 119 1.000
760 118 119 1.000
761 118 120 1.000
762 118 121 1.000
763 119 120 1.000
764 119 121 1.000
765 119 122 1.000
766 120 121 1.000
767 120 122 1.000
768 121 122 1.000
769 121 123 1.000
770 121 124 1.000
771 122 123 1.000
772 122 124 1.000
773 123 124 1.000
774 123 125 1.000
775 124 125 1.000
776 124 126 1.000
777 125 126 1.000
778 125 127 1.000
779 125 143 1.000
780 126 127 1.000
781 126 128 1.000
782 126 142 1.000
783 126 143 1.000
784 127 128 1.000
785 127 129 1.000
786 127 142 1.000
787 127 143 1.000
788 127 144 1.000
789 127 156 1.000
790 127 168 1.000
791 127 170 1.000
792 127 194 1.000
793 128 129 1.000
794 128 130 1.000
795 128 132 1.000
796 128 142 1.000
797 128 192 1.000
798 128 193 1.000
799 128 194 1.000
800 129 130 1.000
801 129 131 1.000
802 129 132 1.000
803 129 133 1.000
804 129 142 1.000
805 129 187 1.000
806 129 189 1.000
807 129 192 1.000
808 129 193 1.000
809 129 194 1.000
810 129 322 1.000
811 130 131 1.000
812 130 132 1.000
813 130 133 1.000
814 130 139 1.000
815 130 140 1.000
816 130 141 1.000
817 130 142 1.000
818 130 145 1.000
819 131 132 1.000
820 131 133 1.000
821 131 139 1.000
822 131 189 1.000
823 131 192 1.000
824 132 133 1.000
825 132 134 1.000
826 132 139 1.000
827 132 191 1.000
828 132 192 1.000
829 132 193 1.000
830 133 134 1.000
831 133 135 1.000
832 133 139 1.000
833 133 140 1.000
834 134 135 1.000
835 134 136 1.000
836 135 136 1.000
837 135 137 1.000
838 135 138 1.000
839 135 139 1.000
840 135 140 1.000
841 136 137 1.000
842 136 138 1.000
843 137 138 1.000
844 137 139 1.000
845 138 139 1.000
846 138 140 1.000
847 139 140 1.000
848 139 141 1.000
849 140 141 1.000
850 140 142 1.000
851 141 142 1.000
852 141 143 1.000
853 141 145 1.000
854 141 146 1.000
855 142 143 1.000
856 142 144 1.000
857 142 145 1.000
858 142 146 1.000
859 142 147 1.000
860 143 144 1.000
861 143 145 1.000
862 143 146 1.000
863 143 147 1.000
864 143 170 1.000
865 144 145 1.000
866 144 146 1.000
867 144 147 1.000
868 144 148 1.000
869 144 151 1.000
870 144 154 1.000
871 144 155 1.000
872 144 156 1.000
873 144 170 1.000
874 144 194 1.000
875 144 316 1.000
876 144 318 1.000
877 145 146 1.000
878 145 147 1.000
879 145 148 1.000
880 145 149 1.000
881 146 147 1.000
882 146 148 1.000
883 146 149 1.000
884 147 148 1.000
885 147 149 1.000
886 147 150 1.000
887 147 151 1.000
888 148 149 1.000
889 148 150 1.000
890 148 151 1.000
891 148 154 1.000
892 148 318 1.000
893 149 150 1.000
894 149 151 1.000
895 150 151 1.000
896 150 152 1.000
897 151 152 1.000
898 151 153 1.000
899 151 154 1.000
900 151 155 1.000
901 151 170 1.000
902 151 171 1.000
903 152 153 1.000
904 152 154 1.000
905 152 171 1.000
906 153 154 1.000
907 153 155 1.000
908 153 171 1.000
909 153 172 1.000
910 154 155 1.000
911 154 156 1.000
912 154 316 1.000
913 154 317 1.000
914 154 318 1.000
915 154 319 1.000
916 155 156 1.000
917 155 157 1.000
918 155 169 1.000
919 155 170 1.000
920 155 171 1.000
921 155 172 1.000
922 155 173 1.000
923 155 315 1.000
924 155 316 1.000
925 155 317 1.000
926 155 318 1.000
927 156 157 1.000
928 156 158 1.000
929 156 168 1.000
930 156 169 1.000
931 156 170 1.000
932 156 171 1.000
933 156 194 1.000
934 156 314 1.000
935 156 315 1.000
936 156 316 1.000
937 156 317 1.000
938 157 158 1.000
939 157 159 1.000
940 157 167 1.000
941 157 168 1.000
942 157 169 1.000
943 157 172 1.000
944 157 173 1.000
945 157 313 1.000
946 157 314 1.000
947 157 315 1.000
948 157 316 1.000
949 158 159 1.000
950 158 160 1.000
951 158 167 1.000
952 158 168 1.000
953 158 219 1.000
954 158 312 1.000
955 158 313 1.000
956 158 314 1.000
957 158 316 1.000
958 159 160 1.000
959 159 161 1.000
960 159 166 1.000
961 159 167 1.000
962 159 177 1.000
963 159 312 1.000
964 159 313 1.000
965 159 329 1.000
966 160 161 1.000
967 160 162 1.000
968 160 166 1.000
969 160 167 1.000
970 160 168 1.000
971 160 219 1.000
972 160 306 1.000
973 160 309 1.000
974 160 310 1.000
975 160 312 1.000
976 160 329 1.000
977 161 162 1.000
978 161 163 1.000
979 161 164 1.000
980 161 165 1.000
981 161 166 1.000
982 161 310 1.000
983 161 329 1.000
984 162 163 1.000
985 162 164 1.000
986 162 275 1.000
987 162 276 1.000
988 162 310 1.000
989 163 164 1.000
990 163 165 1.000
991 163 279 1.000
992 164 165 1.000
993 164 166 1.000
994 165 166 1.000
995 165 167 1.000
996 166 167 1.000
997 166 168 1.000
998 167 168 1.000
999 167 169 1.000
1000 168 169 1.000
1001 168 170 1.000
1002 168 219 1.000
1003 169 170 1.000
1004 169 171 1.000
1005 169 172 1.000
1006 169 174 1.000
1007 170 171 1.000
1008 170 172 1.000
1009 171 172 1.000
1010 171 173 1.000
1011 172 173 1.000
1012 172 174 1.000
1013 173 174 1.000
1014 173 175 1.000
1015 173 178 1.000
1016 173 182 1.000
1017 173 184 1.000
1018 173 313 1.000
1019 173 315 1.000
1020 174 175 1.000
1021 174 176 1.000
1022 174 177 1.000
1023 174 178 1.000
1024 174 313 1.000
1025 175 176 1.000
1026 175 177 1.000
1027 175 178 1.000
1028 176 177 1.000
1029 176 178 1.000
1030 177 178 1.000
1031 177 179 1.000
1032 177 313 1.000
1033 177 329 1.000
1034 178 179 1.000
1035 178 180 1.000
1036 178 181 1.000
1037 178 182 1.000
1038 178 313 1.000
1039 178 327 1.000
1040 178 328 1.000
1041 178 329 1.000
1042 179 180 1.000
1043 179 181 1.000
1044 179 327 1.000
1045 179 328 1.000
1046 179 329 1.000
1047 180 181 1.000
1048 180 182 1.000
1049 181 182 1.000
1050 181 183 1.000
1051 181 326 1.000
1052 181 327 1.000
1053 182 183 1.000
1054 182 184 1.000
1055 182 313 1.000
1056 182 315 1.000
1057 182 325 1.000
1058 182 326 1.000
1059 182 327 1.000
1060 183 184 1.000
1061 183 185 1.000
1062 183 265 1.000
1063 183 266 1.000
1064 183 268 1.000
1065 183 324 1.000
1066 183 325 1.000
1067 183 326 1.000
1068 183 327 1.000
1069 184 185 1.000
1070 184 186 1.000
1071 184 265 1.000
1072 184 315 1.000
1073 184 317 1.000
1074 184 323 1.000
1075 184 324 1.000
1076 184 325 1.000
1077 184 326 1.000
1078 185 186 1.000
1079 185 187 1.000
1080 185 196 1.000
1081 185 197 1.000
1082 185 265 1.000
1083 185 266 1.000
1084 185 323 1.000
1085 185 324 1.000
1086 185 325 1.000
1087 185 326 1.000
1088 186 187 1.000
1089 186 188 1.000
1090 186 195 1.000
1091 186 196 1.000
1092 186 197 1.000
1093 186 322 1.000
1094 186 323 1.000
1095 187 188 1.000
1096 187 189 1.000
1097 187 193 1.000
1098 187 194 1.000
1099 187 195 1.000
1100 187 196 1.000
1101 187 322 1.000
1102 187 323 1.000
1103 187 324 1.000
1104 188 189 1.000
1105 188 190 1.000
1106 188 191 1.000
1107 188 193 1.000
1108 188 194 1.000
1109 188 195 1.000
1110 188 196 1.000
1111 189 190 1.000
1112 189 191 1.000
1113 189 192 1.000
1114 189 193 1.000
1115 189 322 1.000
1116 190 191 1.000
1117 190 192 1.000
1118 191 192 1.000
1119 191 193 1.000
1120 191 195 1.000
1121 192 193 1.000
1122 192 194 1.000
1123 193 194 1.000
1124 193 195 1.000
1125 193 216 1.000
1126 193 301 1.000
1127 194 195 1.000
1128 194 196 1.000
1129 194 215 1.000
1130 194 216 1.000
1131 194 217 1.000
1132 194 316 1.000
1133 194 317 1.000
1134 194 318 1.000
1135 194 322 1.000
1136 194 323 1.000
1137 194 324 1.000
1138 195 196 1.000
1139 195 197 1.000
1140 195 214 1.000
1141 195 215 1.000
1142 195 216 1.000
1143 196 197 1.000
1144 196 198 1.000
1145 196 213 1.000
1146 196 214 1.000
1147 196 215 1.000
1148 196 216 1.000
1149 196 217 1.000
1150 196 263 1.000
1151 196 264 1.000
1152 196 265 1.000
1153 196 304 1.000
1154 196 324 1.000
1155 196 326 1.000
1156 197 198 1.000
1157 197 199 1.000
1158 197 212 1.000
1159 197 213 1.000
1160 197 214 1.000
1161 197 215 1.000
1162 198 199 1.000
1163 198 200 1.000
1164 198 211 1.000
1165 198 212 1.000
1166 198 213 1.000
1167 198 214 1.000
1168 198 263 1.000
1169 198 264 1.000
1170 198 265 1.000
1171 198 304 1.000
1172 199 200 1.000
1173 199 201 1.000
1174 199 208 1.000
1175 199 209 1.000
1176 199 210 1.000
1177 199 211 1.000
1178 199 212 1.000
1179 199 264 1.000
1180 199 265 1.000
1181 199 266 1.000
1182 199 268 1.000
1183 199 269 1.000
1184 200 201 1.000
1185 200 202 1.000
1186 200 208 1.000
1187 200 209 1.000
1188 200 210 1.000
1189 200 211 1.000
1190 200 213 1.000
1191 200 262 1.000
1192 200 263 1.000
1193 200 264 1.000
1194 201 202 1.000
1195 201 203 1.000
1196 201 207 1.000
1197 201 208 1.000
1198 201 209 1.000
1199 201 211 1.000
1200 201 213 1.000
1201 201 229 1.000
1202 201 230 1.000
1203 201 233 1.000
1204 201 261 1.000
1205 201 262 1.000
1206 201 263 1.000
1207 201 264 1.000
1208 202 203 1.000
1209 202 204 1.000
1210 202 206 1.000
1211 202 207 1.000
1212 202 208 1.000
1213 202 209 1.000
1214 202 260 1.000
1215 202 261 1.000
1216 202 262 1.000
1217 203 204 1.000
1218 203 205 1.000
1219 203 206 1.000
1220 203 207 1.000
1221 203 233 1.000
1222 203 234 1.000
1223 203 237 1.000
1224 203 259 1.000
1225 203 260 1.000
1226 203 261 1.000
1227 204 205 1.000
1228 204 206 1.000
1229 204 259 1.000
1230 204 260 1.000
1231 204 261 1.000
1232 204 262 1.000
1233 205 206 1.000
1234 205 207 1.000
1235 206 207 1.000
1236 206 208 1.000
1237 207 208 1.000
1238 207 209 1.000
1239 208 209 1.000
1240 208 210 1.000
1241 208 262 1.000
1242 208 263 1.000
1243 208 264 1.000
1244 208 269 1.000
1245 209 210 1.000
1246 209 211 1.000
1247 210 211 1.000
1248 210 212 1.000
1249 211 212 1.000
1250 211 213 1.000
1251 212 213 1.000
1252 212 214 1.000
1253 213 214 1.000
1254 213 215 1.000
1255 213 226 1.000
1256 213 227 1.000
1257 213 230 1.000
1258 213 302 1.000
1259 213 304 1.000
1260 214 215 1.000
1261 214 216 1.000
1262 214 302 1.000
1263 215 216 1.000
1264 215 217 1.000
1265 215 301 1.000
1266 215 302 1.000
1267 215 303 1.000
1268 215 304 1.000
1269 216 217 1.000
1270 216 218 1.000
1271 216 301 1.000
1272 216 302 1.000
1273 216 303 1.000
1274 216 304 1.000
1275 216 305 1.000
1276 217 218 1.000
1277 217 219 1.000
1278 217 304 1.000
1279 217 309 1.000
1280 217 316 1.000
1281 217 324 1.000
1282 217 326 1.000
1283 218 219 1.000
1284 218 220 1.000
1285 218 221 1.000
1286 218 303 1.000
1287 218 304 1.000
1288 218 305 1.000
1289 218 306 1.000
1290 218 309 1.000
1291 219 220 1.000
1292 219 221 1.000
1293 219 306 1.000
1294 219 309 1.000
1295 219 316 1.000
1296 220 221 1.000
1297 220 222 1.000
1298 220 306 1.000
1299 221 222 1.000
1300 221 223 1.000
1301 221 225 1.000
1302 221 303 1.000
1303 221 305 1.000
1304 221 306 1.000
1305 222 223 1.000
1306 222 224 1.000
1307 222 279 1.000
1308 222 305 1.000
1309 222 306 1.000
1310 222 307 1.000
1311 223 224 1.000
1312 223 225 1.000
1313 223 279 1.000
1314 223 290 1.000
1315 223 291 1.000
1316 223 292 1.000
1317 223 294 1.000
1318 223 303 1.000
1319 223 304 1.000
1320 223 305 1.000
1321 223 306 1.000
1322 223 307 1.000
1323 224 225 1.000
1324 224 226 1.000
1325 224 261 1.000
1326 224 272 1.000
1327 224 292 1.000
1328 224 293 1.000
1329 224 294 1.000
1330 224 303 1.000
1331 224 304 1.000
1332 224 305 1.000
1333 224 307 1.000
1334 224 308 1.000
1335 225 226 1.000
1336 225 227 1.000
1337 225 294 1.000
1338 225 295 1.000
1339 225 296 1.000
1340 225 299 1.000
1341 225 301 1.000
1342 225 302 1.000
1343 225 303 1.000
1344 225 304 1.000
1345 226 227 1.000
1346 226 228 1.000
1347 226 230 1.000
1348 226 231 1.000
1349 226 261 1.000
1350 226 293 1.000
1351 226 294 1.000
1352 226 295 1.000
1353 226 296 1.000
1354 226 297 1.000
1355 226 302 1.000
1356 226 304 1.000
1357 227 228 1.000
1358 227 229 1.000
1359 227 230 1.000
1360 227 231 1.000
1361 227 232 1.000
1362 227 295 1.000
1363 227 296 1.000
1364 227 302 1.000
1365 228 229 1.000
1366 228 230 1.000
1367 228 231 1.000
1368 228 232 1.000
1369 228 233 1.000
1370 228 250 1.000
1371 228 295 1.000
1372 229 230 1.000
1373 229 231 1.000
1374 229 232 1.000
1375 229 233 1.000
1376 230 231 1.000
1377 230 232 1.000
1378 230 233 1.000
1379 230 234 1.000
1380 230 261 1.000
1381 231 232 1.000
1382 231 233 1.000
1383 231 234 1.000
1384 231 235 1.000
1385 231 236 1.000
1386 231 250 1.000
1387 231 293 1.000
1388 231 294 1.000
1389 231 295 1.000
1390 232 233 1.000
1391 232 234 1.000
1392 232 235 1.000
1393 232 236 1.000
1394 232 250 1.000
1395 233 234 1.000
1396 233 235 1.000
1397 233 236 1.000
1398 233 237 1.000
1399 234 235 1.000
1400 234 236 1.000
1401 234 237 1.000
1402 234 238 1.000
1403 234 258 1.000
1404 234 259 1.000
1405 234 260 1.000
1406 234 261 1.000
1407 234 274 1.000
1408 234 277 1.000
1409 234 293 1.000
1410 235 236 1.000
1411 235 237 1.000
1412 235 238 1.000
1413 235 241 1.000
1414 235 250 1.000
1415 235 252 1.000
1416 235 258 1.000
1417 235 277 1.000
1418 235 291 1.000
1419 235 292 1.000
1420 235 293 1.000
1421 235 294 1.000
1422 236 237 1.000
1423 236 238 1.000
1424 237 238 1.000
1425 237 239 1.000
1426 237 259 1.000
1427 238 239 1.000
1428 238 240 1.000
1429 238 241 1.000
1430 238 252 1.000
1431 238 256 1.000
1432 238 258 1.000
1433 238 259 1.000
1434 239 240 1.000
1435 239 241 1.000
1436 240 241 1.000
1437 240 242 1.000
1438 240 251 1.000
1439 240 252 1.000
1440 240 253 1.000
1441 241 242 1.000
1442 241 243 1.000
1443 241 251 1.000
1444 241 252 1.000
1445 241 253 1.000
1446 242 243 1.000
1447 242 244 1.000
1448 242 249 1.000
1449 242 250 1.000
1450 242 251 1.000
1451 243 244 1.000
1452 243 245 1.000
1453 243 249 1.000
1454 243 250 1.000
1455 243 251 1.000
1456 244 245 1.000
1457 244 246 1.000
1458 244 247 1.000
1459 244 248 1.000
1460 244 249 1.000
1461 244 250 1.000
1462 244 251 1.000
1463 245 246 1.000
1464 245 247 1.000
1465 245 248 1.000
1466 246 247 1.000
1467 246 248 1.000
1468 247 248 1.000
1469 247 249 1.000
1470 247 251 1.000
1471 247 282 1.000
1472 247 290 1.000
1473 248 249 1.000
1474 248 250 1.000
1475 248 290 1.000
1476 248 294 1.000
1477 249 250 1.000
1478 249 251 1.000
1479 249 290 1.000
1480 249 294 1.000
1481 250 251 1.000
1482 250 252 1.000
1483 250 289 1.000
1484 250 290 1.000
1485 250 291 1.000
1486 250 293 1.000
1487 250 294 1.000
1488 251 252 1.000
1489 251 253 1.000
1490 251 282 1.000
1491 251 289 1.000
1492 251 290 1.000
1493 251 291 1.000
1494 252 253 1.000
1495 252 254 1.000
1496 252 256 1.000
1497 252 258 1.000
1498 252 277 1.000
1499 252 278 1.000
1500 252 287 1.000
1501 252 288 1.000
1502 252 289 1.000
1503 252 290 1.000
1504 252 291 1.000
1505 253 254 1.000
1506 253 255 1.000
1507 253 256 1.000
1508 253 287 1.000
1509 253 288 1.000
1510 253 289 1.000
1511 254 255 1.000
1512 254 256 1.000
1513 254 278 1.000
1514 254 281 1.000
1515 254 286 1.000
1516 254 287 1.000
1517 254 288 1.000
1518 254 289 1.000
1519 255 256 1.000
1520 255 257 1.000
1521 255 287 1.000
1522 256 257 1.000
1523 256 258 1.000
1524 257 258 1.000
1525 257 259 1.000
1526 258 259 1.000
1527 258 260 1.000
1528 258 274 1.000
1529 258 275 1.000
1530 258 277 1.000
1531 258 278 1.000
1532 259 260 1.000
1533 259 261 1.000
1534 259 272 1.000
1535 259 273 1.000
1536 259 274 1.000
1537 259 277 1.000
1538 260 261 1.000
1539 260 262 1.000
1540 260 271 1.000
1541 260 272 1.000
1542 260 273 1.000
1543 260 274 1.000
1544 260 277 1.000
1545 261 262 1.000
1546 261 263 1.000
1547 261 270 1.000
1548 261 271 1.000
1549 261 272 1.000
1550 261 277 1.000
1551 261 293 1.000
1552 262 263 1.000
1553 262 264 1.000
1554 262 269 1.000
1555 262 270 1.000
1556 262 271 1.000
1557 262 272 1.000
1558 263 264 1.000
1559 263 265 1.000
1560 263 268 1.000
1561 263 269 1.000
1562 263 270 1.000
1563 263 272 1.000
1564 263 304 1.000
1565 263 308 1.000
1566 263 326 1.000
1567 264 265 1.000
1568 264 266 1.000
1569 264 268 1.000
1570 264 269 1.000
1571 265 266 1.000
1572 265 267 1.000
1573 265 268 1.000
1574 265 269 1.000
1575 265 270 1.000
1576 265 326 1.000
1577 266 267 1.000
1578 266 268 1.000
1579 266 269 1.000
1580 267 268 1.000
1581 267 269 1.000
1582 268 269 1.000
1583 268 270 1.000
1584 269 270 1.000
1585 269 271 1.000
1586 269 328 1.000
1587 270 271 1.000
1588 270 272 1.000
1589 270 308 1.000
1590 270 311 1.000
1591 270 312 1.000
1592 270 326 1.000
1593 270 327 1.000
1594 270 328 1.000
1595 271 272 1.000
1596 271 273 1.000
1597 271 311 1.000
1598 272 273 1.000
1599 272 274 1.000
1600 272 276 1.000
1601 272 277 1.000
1602 272 307 1.000
1603 272 308 1.000
1604 272 311 1.000
1605 273 274 1.000
1606 273 275 1.000
1607 273 276 1.000
1608 273 277 1.000
1609 273 311 1.000
1610 274 275 1.000
1611 274 276 1.000
1612 274 277 1.000
1613 274 278 1.000
1614 275 276 1.000
1615 275 277 1.000
1616 275 278 1.000
1617 276 277 1.000
1618 276 278 1.000
1619 276 279 1.000
1620 276 292 1.000
1621 276 307 1.000
1622 276 310 1.000
1623 276 311 1.000
1624 277 278 1.000
1625 277 279 1.000
1626 277 290 1.000
1627 277 291 1.000
1628 277 292 1.000
1629 277 293 1.000
1630 277 307 1.000
1631 278 279 1.000
1632 278 280 1.000
1633 278 281 1.000
1634 278 289 1.000
1635 278 290 1.000
1636 278 292 1.000
1637 279 280 1.000
1638 279 281 1.000
1639 279 290 1.000
1640 279 291 1.000
1641 279 292 1.000
1642 280 281 1.000
1643 280 282 1.000
1644 280 288 1.000
1645 280 289 1.000
1646 280 290 1.000
1647 281 282 1.000
1648 281 283 1.000
1649 281 284 1.000
1650 281 285 1.000
1651 281 286 1.000
1652 281 288 1.000
1653 281 289 1.000
1654 281 290 1.000
1655 282 283 1.000
1656 282 284 1.000
1657 282 286 1.000
1658 282 288 1.000
1659 282 289 1.000
1660 282 290 1.000
1661 283 284 1.000
1662 283 285 1.000
1663 283 286 1.000
1664 283 288 1.000
1665 284 285 1.000
1666 284 286 1.000
1667 285 286 1.000
1668 285 287 1.000
1669 286 287 1.000
1670 286 288 1.000
1671 287 288 1.000
1672 287 289 1.000
1673 288 289 1.000
1674 288 290 1.000
1675 289 290 1.000
1676 289 291 1.000
1677 290 291 1.000
1678 290 292 1.000
1679 290 294 1.000
1680 291 292 1.000
1681 291 293 1.000
1682 291 294 1.000
1683 292 293 1.000
1684 292 294 1.000
1685 292 307 1.000
1686 293 294 1.000
1687 293 295 1.000
1688 293 307 1.000
1689 294 295 1.000
1690 294 296 1.000
1691 295 296 1.000
1692 295 297 1.000
1693 295 298 1.000
1694 296 297 1.000
1695 296 298 1.000
1696 296 299 1.000
1697 296 300 1.000
1698 296 301 1.000
1699 296 302 1.000
1700 297 298 1.000
1701 297 299 1.000
1702 297 300 1.000
1703 298 299 1.000
1704 298 300 1.000
1705 299 300 1.000
1706 299 301 1.000
1707 299 303 1.000
1708 300 301 1.000
1709 300 302 1.000
1710 301 302 1.000
1711 301 303 1.000
1712 302 303 1.000
1713 302 304 1.000
1714 303 304 1.000
1715 303 305 1.000
1716 304 305 1.000
1717 304 306 1.000
1718 304 308 1.000
1719 304 309 1.000
1720 305 306 1.000
1721 305 307 1.000
1722 305 308 1.000
1723 305 309 1.000
1724 305 310 1.000
1725 306 307 1.000
1726 306 308 1.000
1727 306 309 1.000
1728 306 310 1.000
1729 306 311 1.000
1730 307 308 1.000
1731 307 309 1.000
1732 307 310 1.000
1733 307 311 1.000
1734 308 309 1.000
1735 308 310 1.000
1736 308 311 1.000
1737 308 312 1.000
1738 309 310 1.000
1739 309 311 1.000
1740 309 312 1.000
1741 309 313 1.000
1742 309 314 1.000
1743 309 316 1.000
1744 309 326 1.000
1745 309 329 1.000
1746 310 311 1.000
1747 310 312 1.000
1748 310 329 1.000
1749 311 312 1.000
1750 311 313 1.000
1751 311 327 1.000
1752 311 328 1.000
1753 311 329 1.000
1754 312 313 1.000
1755 312 314 1.000
1756 312 326 1.000
1757 312 327 1.000
1758 312 329 1.000
1759 313 314 1.000
1760 313 315 1.000
1761 313 325 1.000
1762 313 326 1.000
1763 313 327 1.000
1764 313 328 1.000
1765 313 329 1.000
1766 314 315 1.000
1767 314 316 1.000
1768 314 324 1.000
1769 314 325 1.000
1770 314 326 1.000
1771 315 316 1.000
1772 315 317 1.000
1773 315 323 1.000
1774 315 324 1.000
1775 315 325 1.000
1776 315 326 1.000
1777 316 317 1.000
1778 316 318 1.000
1779 316 323 1.000
1780 316 324 1.000
1781 317 318 1.000
1782 317 319 1.000
1783 317 321 1.000
1784 317 322 1.000
1785 317 323 1.000
1786 317 324 1.000
1787 318 319 1.000
1788 318 320 1.000
1789 318 322 1.000
1790 319 320 1.000
1791 319 321 1.000
1792 319 322 1.000
1793 320 321 1.000
1794 320 322 1.000
1795 321 322 1.000
1796 321 323 1.000
1797 322 323 1.000
1798 322 324 1.000
1799 323 324 1.000
1800 323 325 1.000
1801 324 325 1.000
1802 324 326 1.000
1803 325 326 1.000
1804 325 327 1.000
1805 326 327 1.000
1806 326 328 1.000
1807 327 328 1.000
1808 327 329 1.000
1809 328 329 1.000