ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1oewA_BB_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 18672 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: STGSATTTPIDSLDDAYITPVQIGTPAQTLNLDFDTGSSDLWVFSSETTASEVXQTIYTPSKSTTAKLLSGATWSISYGDGSSSSGDVYTDTVSVGGLTVTGQAVESAKKVSSSFTEDSTIDGLLGLAFSTLNTVSPTQQKTFFDNAKASLDSPVFTADLGYHAPGTYNFGFIDTTAYTGSITYTAVSTKQGFWEWTSTGYAVGSGTFKSTSIDGIADTGTTLLYLPATVVSAYWAQVSGAKSSSSVGGYVFPCSATLPSFTFGVGSARIVIPGDYIDFGPISTGSSSCFGGIQSSAGIGINIFGDVALKAAFVVFNGATTPTLGFASK
3 #PDB: 1oew
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: BB
8 #CUTOFF: 5.0
9 1 2 1.000
10 1 3 1.000
11 1 150 1.000
12 1 151 1.000
13 1 152 1.000
14 1 170 1.000
15 1 171 1.000
16 2 3 1.000
17 2 4 1.000
18 2 96 1.000
19 2 97 1.000
20 2 98 1.000
21 2 170 1.000
22 2 171 1.000
23 3 4 1.000
24 3 5 1.000
25 3 95 1.000
26 3 96 1.000
27 3 97 1.000
28 3 98 1.000
29 3 168 1.000
30 3 169 1.000
31 3 170 1.000
32 4 5 1.000
33 4 6 1.000
34 4 95 1.000
35 4 96 1.000
36 4 97 1.000
37 4 168 1.000
38 4 169 1.000
39 4 170 1.000
40 5 6 1.000
41 5 7 1.000
42 5 96 1.000
43 5 166 1.000
44 5 167 1.000
45 5 168 1.000
46 6 7 1.000
47 6 8 1.000
48 6 18 1.000
49 6 19 1.000
50 6 20 1.000
51 6 166 1.000
52 6 167 1.000
53 7 8 1.000
54 7 9 1.000
55 7 18 1.000
56 7 19 1.000
57 7 164 1.000
58 7 165 1.000
59 7 166 1.000
60 7 167 1.000
61 8 9 1.000
62 8 10 1.000
63 8 16 1.000
64 8 17 1.000
65 8 18 1.000
66 8 165 1.000
67 9 10 1.000
68 9 11 1.000
69 9 16 1.000
70 9 17 1.000
71 9 18 1.000
72 9 164 1.000
73 10 11 1.000
74 10 12 1.000
75 10 16 1.000
76 10 17 1.000
77 10 18 1.000
78 11 12 1.000
79 11 13 1.000
80 11 14 1.000
81 11 16 1.000
82 12 13 1.000
83 12 14 1.000
84 13 14 1.000
85 13 15 1.000
86 13 279 1.000
87 14 15 1.000
88 14 16 1.000
89 14 222 1.000
90 15 16 1.000
91 15 17 1.000
92 15 222 1.000
93 16 17 1.000
94 16 18 1.000
95 17 18 1.000
96 17 19 1.000
97 17 32 1.000
98 17 33 1.000
99 17 34 1.000
100 18 19 1.000
101 18 20 1.000
102 18 32 1.000
103 18 33 1.000
104 19 20 1.000
105 19 21 1.000
106 19 30 1.000
107 19 31 1.000
108 19 32 1.000
109 20 21 1.000
110 20 22 1.000
111 20 30 1.000
112 20 31 1.000
113 20 32 1.000
114 20 94 1.000
115 20 95 1.000
116 20 96 1.000
117 21 22 1.000
118 21 23 1.000
119 21 28 1.000
120 21 29 1.000
121 21 30 1.000
122 21 31 1.000
123 21 94 1.000
124 22 23 1.000
125 22 24 1.000
126 22 28 1.000
127 22 29 1.000
128 22 92 1.000
129 22 93 1.000
130 22 94 1.000
131 23 24 1.000
132 23 25 1.000
133 23 26 1.000
134 23 27 1.000
135 23 28 1.000
136 23 29 1.000
137 23 92 1.000
138 23 93 1.000
139 24 25 1.000
140 24 26 1.000
141 24 27 1.000
142 24 28 1.000
143 24 63 1.000
144 24 92 1.000
145 25 26 1.000
146 25 27 1.000
147 25 62 1.000
148 25 63 1.000
149 25 64 1.000
150 25 65 1.000
151 26 27 1.000
152 26 28 1.000
153 26 62 1.000
154 27 28 1.000
155 27 29 1.000
156 28 29 1.000
157 28 30 1.000
158 29 30 1.000
159 29 31 1.000
160 30 31 1.000
161 30 32 1.000
162 31 32 1.000
163 31 33 1.000
164 31 120 1.000
165 31 121 1.000
166 31 122 1.000
167 31 123 1.000
168 32 33 1.000
169 32 34 1.000
170 32 122 1.000
171 32 123 1.000
172 32 124 1.000
173 33 34 1.000
174 33 35 1.000
175 33 123 1.000
176 33 124 1.000
177 33 125 1.000
178 34 35 1.000
179 34 36 1.000
180 34 125 1.000
181 34 219 1.000
182 34 220 1.000
183 35 36 1.000
184 35 37 1.000
185 35 38 1.000
186 35 125 1.000
187 35 126 1.000
188 35 127 1.000
189 35 128 1.000
190 35 219 1.000
191 35 220 1.000
192 36 37 1.000
193 36 38 1.000
194 36 127 1.000
195 36 128 1.000
196 36 194 1.000
197 36 217 1.000
198 36 218 1.000
199 36 219 1.000
200 36 220 1.000
201 37 38 1.000
202 37 39 1.000
203 37 128 1.000
204 37 217 1.000
205 37 218 1.000
206 37 219 1.000
207 37 220 1.000
208 38 39 1.000
209 38 40 1.000
210 38 126 1.000
211 38 127 1.000
212 38 128 1.000
213 39 40 1.000
214 39 41 1.000
215 39 126 1.000
216 39 127 1.000
217 39 128 1.000
218 39 129 1.000
219 39 132 1.000
220 39 133 1.000
221 39 140 1.000
222 39 142 1.000
223 40 41 1.000
224 40 42 1.000
225 40 124 1.000
226 40 125 1.000
227 40 126 1.000
228 41 42 1.000
229 41 43 1.000
230 41 104 1.000
231 41 105 1.000
232 41 106 1.000
233 41 124 1.000
234 41 125 1.000
235 41 126 1.000
236 42 43 1.000
237 42 44 1.000
238 42 106 1.000
239 42 122 1.000
240 42 123 1.000
241 42 124 1.000
242 43 44 1.000
243 43 45 1.000
244 43 106 1.000
245 43 107 1.000
246 43 108 1.000
247 43 122 1.000
248 43 123 1.000
249 44 45 1.000
250 44 46 1.000
251 44 56 1.000
252 44 57 1.000
253 44 58 1.000
254 44 122 1.000
255 44 123 1.000
256 45 46 1.000
257 45 47 1.000
258 45 48 1.000
259 45 57 1.000
260 45 58 1.000
261 45 108 1.000
262 46 47 1.000
263 46 48 1.000
264 46 58 1.000
265 46 59 1.000
266 47 48 1.000
267 47 49 1.000
268 47 108 1.000
269 47 109 1.000
270 48 49 1.000
271 48 50 1.000
272 48 108 1.000
273 48 109 1.000
274 48 110 1.000
275 49 50 1.000
276 49 51 1.000
277 49 52 1.000
278 49 53 1.000
279 49 109 1.000
280 49 110 1.000
281 50 51 1.000
282 50 52 1.000
283 50 53 1.000
284 51 52 1.000
285 51 53 1.000
286 52 53 1.000
287 52 116 1.000
288 55 56 1.000
289 55 57 1.000
290 55 119 1.000
291 56 57 1.000
292 56 58 1.000
293 56 122 1.000
294 57 58 1.000
295 57 59 1.000
296 58 59 1.000
297 58 60 1.000
298 59 60 1.000
299 59 61 1.000
300 59 62 1.000
301 59 63 1.000
302 60 61 1.000
303 60 62 1.000
304 60 63 1.000
305 60 66 1.000
306 61 62 1.000
307 61 63 1.000
308 62 63 1.000
309 62 64 1.000
310 63 64 1.000
311 63 65 1.000
312 63 66 1.000
313 64 65 1.000
314 64 66 1.000
315 65 66 1.000
316 65 67 1.000
317 65 90 1.000
318 65 91 1.000
319 65 92 1.000
320 66 67 1.000
321 66 68 1.000
322 66 90 1.000
323 66 91 1.000
324 67 68 1.000
325 67 69 1.000
326 67 88 1.000
327 67 89 1.000
328 67 90 1.000
329 68 69 1.000
330 68 70 1.000
331 68 88 1.000
332 68 89 1.000
333 68 90 1.000
334 69 70 1.000
335 69 71 1.000
336 69 72 1.000
337 69 88 1.000
338 69 89 1.000
339 69 90 1.000
340 70 71 1.000
341 70 72 1.000
342 71 72 1.000
343 71 73 1.000
344 71 136 1.000
345 71 137 1.000
346 72 73 1.000
347 72 74 1.000
348 72 86 1.000
349 72 87 1.000
350 72 88 1.000
351 72 136 1.000
352 72 137 1.000
353 73 74 1.000
354 73 75 1.000
355 73 86 1.000
356 73 87 1.000
357 73 134 1.000
358 73 135 1.000
359 73 136 1.000
360 74 75 1.000
361 74 76 1.000
362 74 84 1.000
363 74 85 1.000
364 74 86 1.000
365 74 134 1.000
366 74 135 1.000
367 75 76 1.000
368 75 77 1.000
369 75 84 1.000
370 75 85 1.000
371 75 134 1.000
372 76 77 1.000
373 76 78 1.000
374 76 82 1.000
375 76 83 1.000
376 76 84 1.000
377 77 78 1.000
378 77 79 1.000
379 77 82 1.000
380 77 83 1.000
381 78 79 1.000
382 78 80 1.000
383 78 81 1.000
384 78 82 1.000
385 79 80 1.000
386 79 81 1.000
387 80 81 1.000
388 80 82 1.000
389 81 82 1.000
390 81 83 1.000
391 82 83 1.000
392 82 84 1.000
393 83 84 1.000
394 83 85 1.000
395 83 110 1.000
396 83 111 1.000
397 83 112 1.000
398 84 85 1.000
399 84 86 1.000
400 84 110 1.000
401 84 111 1.000
402 84 112 1.000
403 85 86 1.000
404 85 87 1.000
405 85 107 1.000
406 85 108 1.000
407 85 109 1.000
408 85 110 1.000
409 86 87 1.000
410 86 88 1.000
411 86 107 1.000
412 86 108 1.000
413 86 109 1.000
414 87 88 1.000
415 87 89 1.000
416 87 105 1.000
417 87 106 1.000
418 87 107 1.000
419 88 89 1.000
420 88 90 1.000
421 88 105 1.000
422 88 106 1.000
423 88 107 1.000
424 89 90 1.000
425 89 91 1.000
426 89 103 1.000
427 89 104 1.000
428 89 105 1.000
429 89 106 1.000
430 90 91 1.000
431 90 92 1.000
432 90 102 1.000
433 90 103 1.000
434 90 104 1.000
435 90 105 1.000
436 91 92 1.000
437 91 93 1.000
438 91 100 1.000
439 91 101 1.000
440 91 102 1.000
441 91 103 1.000
442 92 93 1.000
443 92 94 1.000
444 92 100 1.000
445 92 101 1.000
446 92 102 1.000
447 93 94 1.000
448 93 95 1.000
449 93 98 1.000
450 93 99 1.000
451 93 100 1.000
452 94 95 1.000
453 94 96 1.000
454 94 98 1.000
455 94 99 1.000
456 94 100 1.000
457 95 96 1.000
458 95 97 1.000
459 95 98 1.000
460 96 97 1.000
461 96 98 1.000
462 97 98 1.000
463 97 99 1.000
464 98 99 1.000
465 98 100 1.000
466 99 100 1.000
467 99 101 1.000
468 100 101 1.000
469 100 102 1.000
470 100 103 1.000
471 101 102 1.000
472 101 103 1.000
473 102 103 1.000
474 102 104 1.000
475 103 104 1.000
476 103 105 1.000
477 104 105 1.000
478 104 106 1.000
479 104 141 1.000
480 105 106 1.000
481 105 107 1.000
482 106 107 1.000
483 106 108 1.000
484 107 108 1.000
485 107 109 1.000
486 108 109 1.000
487 108 110 1.000
488 109 110 1.000
489 109 111 1.000
490 110 111 1.000
491 110 112 1.000
492 111 112 1.000
493 111 113 1.000
494 112 113 1.000
495 112 114 1.000
496 112 115 1.000
497 112 116 1.000
498 113 114 1.000
499 113 115 1.000
500 113 116 1.000
501 113 117 1.000
502 114 115 1.000
503 114 116 1.000
504 114 117 1.000
505 114 118 1.000
506 115 116 1.000
507 115 117 1.000
508 115 118 1.000
509 115 119 1.000
510 115 121 1.000
511 116 117 1.000
512 116 118 1.000
513 116 119 1.000
514 117 118 1.000
515 117 119 1.000
516 118 119 1.000
517 118 120 1.000
518 118 121 1.000
519 119 120 1.000
520 119 121 1.000
521 120 121 1.000
522 120 122 1.000
523 121 122 1.000
524 121 123 1.000
525 122 123 1.000
526 122 124 1.000
527 123 124 1.000
528 123 125 1.000
529 124 125 1.000
530 124 126 1.000
531 125 126 1.000
532 125 127 1.000
533 126 127 1.000
534 126 128 1.000
535 126 142 1.000
536 126 143 1.000
537 127 128 1.000
538 127 129 1.000
539 128 129 1.000
540 128 130 1.000
541 128 192 1.000
542 129 130 1.000
543 129 131 1.000
544 129 132 1.000
545 129 133 1.000
546 129 192 1.000
547 130 131 1.000
548 130 132 1.000
549 130 133 1.000
550 130 140 1.000
551 130 142 1.000
552 131 132 1.000
553 131 133 1.000
554 132 133 1.000
555 132 134 1.000
556 133 134 1.000
557 133 135 1.000
558 133 139 1.000
559 133 140 1.000
560 134 135 1.000
561 134 136 1.000
562 135 136 1.000
563 135 137 1.000
564 135 138 1.000
565 135 139 1.000
566 135 140 1.000
567 136 137 1.000
568 136 138 1.000
569 137 138 1.000
570 137 139 1.000
571 138 139 1.000
572 138 140 1.000
573 139 140 1.000
574 139 141 1.000
575 140 141 1.000
576 140 142 1.000
577 141 142 1.000
578 141 143 1.000
579 142 143 1.000
580 142 144 1.000
581 142 145 1.000
582 142 146 1.000
583 142 147 1.000
584 143 144 1.000
585 143 145 1.000
586 143 146 1.000
587 143 147 1.000
588 144 145 1.000
589 144 146 1.000
590 144 147 1.000
591 144 148 1.000
592 145 146 1.000
593 145 147 1.000
594 145 148 1.000
595 145 149 1.000
596 146 147 1.000
597 146 148 1.000
598 146 149 1.000
599 147 148 1.000
600 147 149 1.000
601 147 150 1.000
602 147 151 1.000
603 148 149 1.000
604 148 150 1.000
605 148 151 1.000
606 149 150 1.000
607 149 151 1.000
608 150 151 1.000
609 150 152 1.000
610 151 152 1.000
611 151 153 1.000
612 151 171 1.000
613 152 153 1.000
614 152 154 1.000
615 152 171 1.000
616 153 154 1.000
617 153 155 1.000
618 153 171 1.000
619 153 172 1.000
620 154 155 1.000
621 154 156 1.000
622 154 316 1.000
623 154 317 1.000
624 154 318 1.000
625 154 319 1.000
626 155 156 1.000
627 155 157 1.000
628 155 169 1.000
629 155 170 1.000
630 155 171 1.000
631 155 172 1.000
632 155 316 1.000
633 155 317 1.000
634 155 318 1.000
635 156 157 1.000
636 156 158 1.000
637 156 169 1.000
638 156 170 1.000
639 156 171 1.000
640 156 314 1.000
641 156 315 1.000
642 156 316 1.000
643 156 317 1.000
644 157 158 1.000
645 157 159 1.000
646 157 167 1.000
647 157 168 1.000
648 157 169 1.000
649 157 314 1.000
650 157 315 1.000
651 157 316 1.000
652 158 159 1.000
653 158 160 1.000
654 158 167 1.000
655 158 168 1.000
656 158 312 1.000
657 158 313 1.000
658 158 314 1.000
659 159 160 1.000
660 159 161 1.000
661 159 166 1.000
662 159 167 1.000
663 159 312 1.000
664 160 161 1.000
665 160 162 1.000
666 160 166 1.000
667 160 167 1.000
668 160 310 1.000
669 160 312 1.000
670 161 162 1.000
671 161 163 1.000
672 161 164 1.000
673 161 165 1.000
674 161 166 1.000
675 162 163 1.000
676 162 164 1.000
677 163 164 1.000
678 163 165 1.000
679 164 165 1.000
680 164 166 1.000
681 165 166 1.000
682 165 167 1.000
683 166 167 1.000
684 166 168 1.000
685 167 168 1.000
686 167 169 1.000
687 168 169 1.000
688 168 170 1.000
689 169 170 1.000
690 169 171 1.000
691 169 172 1.000
692 170 171 1.000
693 170 172 1.000
694 171 172 1.000
695 171 173 1.000
696 172 173 1.000
697 172 174 1.000
698 173 174 1.000
699 173 175 1.000
700 174 175 1.000
701 174 176 1.000
702 174 177 1.000
703 174 178 1.000
704 175 176 1.000
705 175 177 1.000
706 175 178 1.000
707 176 177 1.000
708 176 178 1.000
709 177 178 1.000
710 177 179 1.000
711 177 329 1.000
712 178 179 1.000
713 178 180 1.000
714 178 328 1.000
715 178 329 1.000
716 179 180 1.000
717 179 181 1.000
718 179 327 1.000
719 179 328 1.000
720 179 329 1.000
721 180 181 1.000
722 180 182 1.000
723 181 182 1.000
724 181 183 1.000
725 181 326 1.000
726 181 327 1.000
727 182 183 1.000
728 182 184 1.000
729 182 326 1.000
730 182 327 1.000
731 183 184 1.000
732 183 185 1.000
733 183 324 1.000
734 183 325 1.000
735 183 326 1.000
736 183 327 1.000
737 184 185 1.000
738 184 186 1.000
739 184 324 1.000
740 184 325 1.000
741 184 326 1.000
742 185 186 1.000
743 185 187 1.000
744 185 323 1.000
745 185 324 1.000
746 185 325 1.000
747 186 187 1.000
748 186 188 1.000
749 186 195 1.000
750 186 196 1.000
751 186 197 1.000
752 186 322 1.000
753 186 323 1.000
754 187 188 1.000
755 187 189 1.000
756 187 195 1.000
757 187 196 1.000
758 187 322 1.000
759 187 323 1.000
760 188 189 1.000
761 188 190 1.000
762 188 191 1.000
763 188 193 1.000
764 188 194 1.000
765 188 195 1.000
766 188 196 1.000
767 189 190 1.000
768 189 191 1.000
769 189 192 1.000
770 189 193 1.000
771 190 191 1.000
772 190 192 1.000
773 191 192 1.000
774 191 193 1.000
775 192 193 1.000
776 192 194 1.000
777 193 194 1.000
778 193 195 1.000
779 194 195 1.000
780 194 196 1.000
781 194 215 1.000
782 194 216 1.000
783 194 217 1.000
784 195 196 1.000
785 195 197 1.000
786 195 215 1.000
787 195 216 1.000
788 196 197 1.000
789 196 198 1.000
790 196 213 1.000
791 196 214 1.000
792 196 215 1.000
793 197 198 1.000
794 197 199 1.000
795 197 213 1.000
796 197 214 1.000
797 197 215 1.000
798 198 199 1.000
799 198 200 1.000
800 198 211 1.000
801 198 212 1.000
802 198 213 1.000
803 198 214 1.000
804 198 264 1.000
805 199 200 1.000
806 199 201 1.000
807 199 209 1.000
808 199 210 1.000
809 199 211 1.000
810 199 212 1.000
811 199 264 1.000
812 199 265 1.000
813 199 266 1.000
814 200 201 1.000
815 200 202 1.000
816 200 209 1.000
817 200 210 1.000
818 200 211 1.000
819 200 262 1.000
820 200 263 1.000
821 200 264 1.000
822 201 202 1.000
823 201 203 1.000
824 201 207 1.000
825 201 208 1.000
826 201 209 1.000
827 201 262 1.000
828 201 263 1.000
829 201 264 1.000
830 202 203 1.000
831 202 204 1.000
832 202 206 1.000
833 202 207 1.000
834 202 208 1.000
835 202 209 1.000
836 202 260 1.000
837 202 261 1.000
838 202 262 1.000
839 203 204 1.000
840 203 205 1.000
841 203 206 1.000
842 203 207 1.000
843 203 260 1.000
844 203 261 1.000
845 204 205 1.000
846 204 206 1.000
847 204 259 1.000
848 204 260 1.000
849 204 261 1.000
850 205 206 1.000
851 205 207 1.000
852 206 207 1.000
853 206 208 1.000
854 207 208 1.000
855 207 209 1.000
856 208 209 1.000
857 208 210 1.000
858 209 210 1.000
859 209 211 1.000
860 210 211 1.000
861 210 212 1.000
862 211 212 1.000
863 211 213 1.000
864 212 213 1.000
865 212 214 1.000
866 213 214 1.000
867 213 215 1.000
868 214 215 1.000
869 214 216 1.000
870 214 302 1.000
871 215 216 1.000
872 215 217 1.000
873 215 302 1.000
874 215 303 1.000
875 216 217 1.000
876 216 218 1.000
877 216 302 1.000
878 216 303 1.000
879 216 304 1.000
880 216 305 1.000
881 217 218 1.000
882 217 219 1.000
883 217 304 1.000
884 218 219 1.000
885 218 220 1.000
886 218 221 1.000
887 218 304 1.000
888 218 305 1.000
889 218 306 1.000
890 219 220 1.000
891 219 221 1.000
892 220 221 1.000
893 220 222 1.000
894 221 222 1.000
895 221 223 1.000
896 221 305 1.000
897 221 306 1.000
898 222 223 1.000
899 222 224 1.000
900 222 305 1.000
901 222 306 1.000
902 222 307 1.000
903 223 224 1.000
904 223 225 1.000
905 223 292 1.000
906 223 303 1.000
907 223 304 1.000
908 223 305 1.000
909 223 306 1.000
910 223 307 1.000
911 224 225 1.000
912 224 226 1.000
913 224 292 1.000
914 224 293 1.000
915 224 294 1.000
916 224 303 1.000
917 224 305 1.000
918 224 307 1.000
919 225 226 1.000
920 225 227 1.000
921 225 294 1.000
922 225 295 1.000
923 225 296 1.000
924 225 301 1.000
925 225 302 1.000
926 225 303 1.000
927 225 304 1.000
928 226 227 1.000
929 226 228 1.000
930 226 294 1.000
931 226 295 1.000
932 226 296 1.000
933 226 297 1.000
934 227 228 1.000
935 227 229 1.000
936 227 230 1.000
937 227 231 1.000
938 227 232 1.000
939 227 296 1.000
940 228 229 1.000
941 228 230 1.000
942 228 231 1.000
943 228 232 1.000
944 228 233 1.000
945 228 295 1.000
946 229 230 1.000
947 229 231 1.000
948 229 232 1.000
949 229 233 1.000
950 230 231 1.000
951 230 232 1.000
952 230 233 1.000
953 230 234 1.000
954 231 232 1.000
955 231 233 1.000
956 231 234 1.000
957 231 235 1.000
958 231 236 1.000
959 232 233 1.000
960 232 234 1.000
961 232 235 1.000
962 232 236 1.000
963 233 234 1.000
964 233 235 1.000
965 233 236 1.000
966 233 237 1.000
967 234 235 1.000
968 234 236 1.000
969 234 237 1.000
970 234 238 1.000
971 235 236 1.000
972 235 237 1.000
973 235 238 1.000
974 235 241 1.000
975 236 237 1.000
976 236 238 1.000
977 237 238 1.000
978 237 239 1.000
979 238 239 1.000
980 238 240 1.000
981 238 241 1.000
982 239 240 1.000
983 239 241 1.000
984 240 241 1.000
985 240 242 1.000
986 240 251 1.000
987 240 252 1.000
988 240 253 1.000
989 241 242 1.000
990 241 243 1.000
991 241 251 1.000
992 241 252 1.000
993 242 243 1.000
994 242 244 1.000
995 242 249 1.000
996 242 250 1.000
997 242 251 1.000
998 243 244 1.000
999 243 245 1.000
1000 243 249 1.000
1001 243 250 1.000
1002 243 251 1.000
1003 244 245 1.000
1004 244 246 1.000
1005 244 247 1.000
1006 244 248 1.000
1007 244 249 1.000
1008 244 250 1.000
1009 245 246 1.000
1010 245 247 1.000
1011 245 248 1.000
1012 246 247 1.000
1013 246 248 1.000
1014 247 248 1.000
1015 247 249 1.000
1016 248 249 1.000
1017 248 250 1.000
1018 249 250 1.000
1019 249 251 1.000
1020 250 251 1.000
1021 250 252 1.000
1022 250 289 1.000
1023 250 290 1.000
1024 250 291 1.000
1025 251 252 1.000
1026 251 253 1.000
1027 251 289 1.000
1028 251 290 1.000
1029 251 291 1.000
1030 252 253 1.000
1031 252 254 1.000
1032 252 287 1.000
1033 252 288 1.000
1034 252 289 1.000
1035 253 254 1.000
1036 253 255 1.000
1037 253 256 1.000
1038 253 287 1.000
1039 253 288 1.000
1040 253 289 1.000
1041 254 255 1.000
1042 254 256 1.000
1043 254 287 1.000
1044 254 288 1.000
1045 254 289 1.000
1046 255 256 1.000
1047 255 257 1.000
1048 255 287 1.000
1049 256 257 1.000
1050 256 258 1.000
1051 257 258 1.000
1052 257 259 1.000
1053 258 259 1.000
1054 258 260 1.000
1055 258 274 1.000
1056 258 275 1.000
1057 259 260 1.000
1058 259 261 1.000
1059 259 272 1.000
1060 259 273 1.000
1061 259 274 1.000
1062 260 261 1.000
1063 260 262 1.000
1064 260 272 1.000
1065 260 273 1.000
1066 260 274 1.000
1067 261 262 1.000
1068 261 263 1.000
1069 261 270 1.000
1070 261 271 1.000
1071 261 272 1.000
1072 262 263 1.000
1073 262 264 1.000
1074 262 270 1.000
1075 262 271 1.000
1076 262 272 1.000
1077 263 264 1.000
1078 263 265 1.000
1079 263 268 1.000
1080 263 269 1.000
1081 263 270 1.000
1082 264 265 1.000
1083 264 266 1.000
1084 264 268 1.000
1085 264 269 1.000
1086 265 266 1.000
1087 265 267 1.000
1088 265 268 1.000
1089 265 269 1.000
1090 266 267 1.000
1091 266 268 1.000
1092 267 268 1.000
1093 267 269 1.000
1094 268 269 1.000
1095 268 270 1.000
1096 269 270 1.000
1097 269 271 1.000
1098 270 271 1.000
1099 270 272 1.000
1100 271 272 1.000
1101 271 273 1.000
1102 271 311 1.000
1103 272 273 1.000
1104 272 274 1.000
1105 273 274 1.000
1106 273 275 1.000
1107 273 276 1.000
1108 273 277 1.000
1109 274 275 1.000
1110 274 276 1.000
1111 274 277 1.000
1112 274 278 1.000
1113 275 276 1.000
1114 275 277 1.000
1115 275 278 1.000
1116 276 277 1.000
1117 276 278 1.000
1118 276 279 1.000
1119 276 292 1.000
1120 277 278 1.000
1121 277 279 1.000
1122 277 290 1.000
1123 277 291 1.000
1124 277 292 1.000
1125 277 293 1.000
1126 278 279 1.000
1127 278 280 1.000
1128 278 290 1.000
1129 278 292 1.000
1130 279 280 1.000
1131 279 281 1.000
1132 279 290 1.000
1133 279 291 1.000
1134 279 292 1.000
1135 280 281 1.000
1136 280 282 1.000
1137 280 288 1.000
1138 280 289 1.000
1139 280 290 1.000
1140 281 282 1.000
1141 281 283 1.000
1142 281 288 1.000
1143 281 289 1.000
1144 281 290 1.000
1145 282 283 1.000
1146 282 284 1.000
1147 282 288 1.000
1148 282 289 1.000
1149 282 290 1.000
1150 283 284 1.000
1151 283 285 1.000
1152 283 286 1.000
1153 283 288 1.000
1154 284 285 1.000
1155 284 286 1.000
1156 285 286 1.000
1157 285 287 1.000
1158 286 287 1.000
1159 286 288 1.000
1160 287 288 1.000
1161 287 289 1.000
1162 288 289 1.000
1163 288 290 1.000
1164 289 290 1.000
1165 289 291 1.000
1166 290 291 1.000
1167 290 292 1.000
1168 291 292 1.000
1169 291 293 1.000
1170 292 293 1.000
1171 292 294 1.000
1172 293 294 1.000
1173 293 295 1.000
1174 294 295 1.000
1175 294 296 1.000
1176 295 296 1.000
1177 295 297 1.000
1178 295 298 1.000
1179 296 297 1.000
1180 296 298 1.000
1181 296 299 1.000
1182 296 300 1.000
1183 296 301 1.000
1184 297 298 1.000
1185 297 299 1.000
1186 297 300 1.000
1187 298 299 1.000
1188 298 300 1.000
1189 299 300 1.000
1190 299 301 1.000
1191 300 301 1.000
1192 300 302 1.000
1193 301 302 1.000
1194 301 303 1.000
1195 302 303 1.000
1196 302 304 1.000
1197 303 304 1.000
1198 303 305 1.000
1199 304 305 1.000
1200 304 306 1.000
1201 305 306 1.000
1202 305 307 1.000
1203 305 308 1.000
1204 305 309 1.000
1205 305 310 1.000
1206 306 307 1.000
1207 306 308 1.000
1208 306 309 1.000
1209 306 310 1.000
1210 306 311 1.000
1211 307 308 1.000
1212 307 309 1.000
1213 307 310 1.000
1214 307 311 1.000
1215 308 309 1.000
1216 308 310 1.000
1217 308 311 1.000
1218 308 312 1.000
1219 309 310 1.000
1220 309 311 1.000
1221 309 312 1.000
1222 309 313 1.000
1223 310 311 1.000
1224 310 312 1.000
1225 311 312 1.000
1226 311 313 1.000
1227 311 327 1.000
1228 311 328 1.000
1229 311 329 1.000
1230 312 313 1.000
1231 312 314 1.000
1232 312 327 1.000
1233 313 314 1.000
1234 313 315 1.000
1235 313 325 1.000
1236 313 326 1.000
1237 313 327 1.000
1238 313 328 1.000
1239 314 315 1.000
1240 314 316 1.000
1241 314 325 1.000
1242 314 326 1.000
1243 315 316 1.000
1244 315 317 1.000
1245 315 323 1.000
1246 315 324 1.000
1247 315 325 1.000
1248 315 326 1.000
1249 316 317 1.000
1250 316 318 1.000
1251 316 323 1.000
1252 317 318 1.000
1253 317 319 1.000
1254 317 321 1.000
1255 317 322 1.000
1256 317 323 1.000
1257 317 324 1.000
1258 318 319 1.000
1259 318 320 1.000
1260 318 322 1.000
1261 319 320 1.000
1262 319 321 1.000
1263 319 322 1.000
1264 320 321 1.000
1265 320 322 1.000
1266 321 322 1.000
1267 321 323 1.000
1268 322 323 1.000
1269 322 324 1.000
1270 323 324 1.000
1271 323 325 1.000
1272 324 325 1.000
1273 324 326 1.000
1274 325 326 1.000
1275 325 327 1.000
1276 326 327 1.000
1277 326 328 1.000
1278 327 328 1.000
1279 327 329 1.000
1280 328 329 1.000