ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1oewA_Ca_8.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 25026 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: STGSATTTPIDSLDDAYITPVQIGTPAQTLNLDFDTGSSDLWVFSSETTASEVXQTIYTPSKSTTAKLLSGATWSISYGDGSSSSGDVYTDTVSVGGLTVTGQAVESAKKVSSSFTEDSTIDGLLGLAFSTLNTVSPTQQKTFFDNAKASLDSPVFTADLGYHAPGTYNFGFIDTTAYTGSITYTAVSTKQGFWEWTSTGYAVGSGTFKSTSIDGIADTGTTLLYLPATVVSAYWAQVSGAKSSSSVGGYVFPCSATLPSFTFGVGSARIVIPGDYIDFGPISTGSSSCFGGIQSSAGIGINIFGDVALKAAFVVFNGATTPTLGFASK
3 #PDB: 1oew
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: Ca
8 #CUTOFF: 8.0
9 1 2 1.000
10 1 3 1.000
11 1 98 1.000
12 1 150 1.000
13 1 151 1.000
14 1 152 1.000
15 1 171 1.000
16 2 3 1.000
17 2 4 1.000
18 2 97 1.000
19 2 98 1.000
20 2 151 1.000
21 2 152 1.000
22 2 169 1.000
23 2 170 1.000
24 2 171 1.000
25 2 172 1.000
26 3 4 1.000
27 3 5 1.000
28 3 95 1.000
29 3 96 1.000
30 3 97 1.000
31 3 98 1.000
32 3 169 1.000
33 3 170 1.000
34 3 171 1.000
35 4 5 1.000
36 4 6 1.000
37 4 95 1.000
38 4 96 1.000
39 4 97 1.000
40 4 98 1.000
41 4 167 1.000
42 4 168 1.000
43 4 169 1.000
44 4 170 1.000
45 5 6 1.000
46 5 7 1.000
47 5 19 1.000
48 5 20 1.000
49 5 95 1.000
50 5 96 1.000
51 5 97 1.000
52 5 167 1.000
53 5 168 1.000
54 5 169 1.000
55 6 7 1.000
56 6 8 1.000
57 6 19 1.000
58 6 20 1.000
59 6 96 1.000
60 6 165 1.000
61 6 166 1.000
62 6 167 1.000
63 6 168 1.000
64 7 8 1.000
65 7 9 1.000
66 7 17 1.000
67 7 18 1.000
68 7 19 1.000
69 7 20 1.000
70 7 160 1.000
71 7 165 1.000
72 7 166 1.000
73 7 167 1.000
74 7 168 1.000
75 8 9 1.000
76 8 10 1.000
77 8 17 1.000
78 8 18 1.000
79 8 19 1.000
80 8 161 1.000
81 8 164 1.000
82 8 165 1.000
83 8 166 1.000
84 9 10 1.000
85 9 11 1.000
86 9 12 1.000
87 9 13 1.000
88 9 14 1.000
89 9 15 1.000
90 9 16 1.000
91 9 17 1.000
92 9 18 1.000
93 9 161 1.000
94 9 163 1.000
95 9 164 1.000
96 9 165 1.000
97 10 11 1.000
98 10 12 1.000
99 10 14 1.000
100 10 15 1.000
101 10 16 1.000
102 10 17 1.000
103 10 18 1.000
104 10 120 1.000
105 10 121 1.000
106 11 12 1.000
107 11 13 1.000
108 11 14 1.000
109 11 15 1.000
110 11 16 1.000
111 12 13 1.000
112 12 14 1.000
113 12 15 1.000
114 12 163 1.000
115 13 14 1.000
116 13 15 1.000
117 13 163 1.000
118 13 279 1.000
119 13 280 1.000
120 14 15 1.000
121 14 16 1.000
122 14 17 1.000
123 14 162 1.000
124 14 163 1.000
125 14 222 1.000
126 15 16 1.000
127 15 17 1.000
128 15 222 1.000
129 16 17 1.000
130 16 18 1.000
131 16 33 1.000
132 16 220 1.000
133 16 221 1.000
134 16 222 1.000
135 16 306 1.000
136 17 18 1.000
137 17 19 1.000
138 17 33 1.000
139 17 34 1.000
140 18 19 1.000
141 18 20 1.000
142 18 31 1.000
143 18 32 1.000
144 18 33 1.000
145 18 34 1.000
146 18 120 1.000
147 18 121 1.000
148 19 20 1.000
149 19 21 1.000
150 19 31 1.000
151 19 32 1.000
152 19 33 1.000
153 19 34 1.000
154 20 21 1.000
155 20 22 1.000
156 20 29 1.000
157 20 30 1.000
158 20 31 1.000
159 20 32 1.000
160 20 95 1.000
161 20 96 1.000
162 21 22 1.000
163 21 23 1.000
164 21 29 1.000
165 21 30 1.000
166 21 31 1.000
167 21 32 1.000
168 21 93 1.000
169 21 94 1.000
170 21 95 1.000
171 21 96 1.000
172 22 23 1.000
173 22 24 1.000
174 22 27 1.000
175 22 28 1.000
176 22 29 1.000
177 22 30 1.000
178 22 93 1.000
179 22 94 1.000
180 22 95 1.000
181 23 24 1.000
182 23 25 1.000
183 23 27 1.000
184 23 28 1.000
185 23 29 1.000
186 23 30 1.000
187 23 58 1.000
188 23 91 1.000
189 23 92 1.000
190 23 93 1.000
191 23 94 1.000
192 24 25 1.000
193 24 26 1.000
194 24 27 1.000
195 24 28 1.000
196 24 60 1.000
197 24 63 1.000
198 24 64 1.000
199 24 65 1.000
200 24 66 1.000
201 24 91 1.000
202 24 92 1.000
203 24 93 1.000
204 25 26 1.000
205 25 27 1.000
206 25 28 1.000
207 25 62 1.000
208 25 63 1.000
209 25 64 1.000
210 25 65 1.000
211 25 66 1.000
212 25 92 1.000
213 26 27 1.000
214 26 28 1.000
215 26 62 1.000
216 26 63 1.000
217 26 64 1.000
218 27 28 1.000
219 27 29 1.000
220 27 63 1.000
221 28 29 1.000
222 28 30 1.000
223 28 58 1.000
224 29 30 1.000
225 29 31 1.000
226 30 31 1.000
227 30 32 1.000
228 30 56 1.000
229 30 57 1.000
230 30 58 1.000
231 30 122 1.000
232 30 123 1.000
233 31 32 1.000
234 31 33 1.000
235 31 56 1.000
236 31 120 1.000
237 31 121 1.000
238 31 122 1.000
239 31 123 1.000
240 32 33 1.000
241 32 34 1.000
242 32 43 1.000
243 32 121 1.000
244 32 122 1.000
245 32 123 1.000
246 32 124 1.000
247 32 125 1.000
248 33 34 1.000
249 33 35 1.000
250 33 121 1.000
251 33 122 1.000
252 33 123 1.000
253 33 124 1.000
254 33 125 1.000
255 33 220 1.000
256 34 35 1.000
257 34 36 1.000
258 34 124 1.000
259 34 125 1.000
260 34 126 1.000
261 34 127 1.000
262 34 219 1.000
263 34 220 1.000
264 35 36 1.000
265 35 37 1.000
266 35 38 1.000
267 35 39 1.000
268 35 124 1.000
269 35 125 1.000
270 35 126 1.000
271 35 127 1.000
272 35 128 1.000
273 35 218 1.000
274 35 219 1.000
275 35 220 1.000
276 36 37 1.000
277 36 38 1.000
278 36 39 1.000
279 36 126 1.000
280 36 127 1.000
281 36 128 1.000
282 36 193 1.000
283 36 194 1.000
284 36 217 1.000
285 36 218 1.000
286 36 219 1.000
287 36 220 1.000
288 37 38 1.000
289 37 39 1.000
290 37 126 1.000
291 37 127 1.000
292 37 128 1.000
293 37 193 1.000
294 37 194 1.000
295 37 216 1.000
296 37 217 1.000
297 37 218 1.000
298 37 219 1.000
299 37 220 1.000
300 37 221 1.000
301 38 39 1.000
302 38 40 1.000
303 38 126 1.000
304 38 127 1.000
305 38 128 1.000
306 38 129 1.000
307 38 132 1.000
308 38 133 1.000
309 38 193 1.000
310 39 40 1.000
311 39 41 1.000
312 39 125 1.000
313 39 126 1.000
314 39 127 1.000
315 39 128 1.000
316 39 129 1.000
317 39 130 1.000
318 39 131 1.000
319 39 132 1.000
320 39 133 1.000
321 39 134 1.000
322 39 141 1.000
323 39 142 1.000
324 40 41 1.000
325 40 42 1.000
326 40 106 1.000
327 40 124 1.000
328 40 125 1.000
329 40 126 1.000
330 40 127 1.000
331 40 132 1.000
332 40 133 1.000
333 40 134 1.000
334 40 142 1.000
335 41 42 1.000
336 41 43 1.000
337 41 104 1.000
338 41 105 1.000
339 41 106 1.000
340 41 123 1.000
341 41 124 1.000
342 41 125 1.000
343 41 126 1.000
344 41 142 1.000
345 41 143 1.000
346 42 43 1.000
347 42 44 1.000
348 42 105 1.000
349 42 106 1.000
350 42 107 1.000
351 42 108 1.000
352 42 123 1.000
353 42 124 1.000
354 42 125 1.000
355 43 44 1.000
356 43 45 1.000
357 43 57 1.000
358 43 58 1.000
359 43 105 1.000
360 43 106 1.000
361 43 107 1.000
362 43 108 1.000
363 43 122 1.000
364 43 123 1.000
365 43 124 1.000
366 44 45 1.000
367 44 46 1.000
368 44 47 1.000
369 44 48 1.000
370 44 53 1.000
371 44 55 1.000
372 44 56 1.000
373 44 57 1.000
374 44 58 1.000
375 44 107 1.000
376 44 108 1.000
377 44 111 1.000
378 44 122 1.000
379 44 123 1.000
380 45 46 1.000
381 45 47 1.000
382 45 48 1.000
383 45 57 1.000
384 45 58 1.000
385 45 59 1.000
386 45 60 1.000
387 45 107 1.000
388 45 108 1.000
389 45 109 1.000
390 46 47 1.000
391 46 48 1.000
392 46 57 1.000
393 46 58 1.000
394 46 59 1.000
395 46 60 1.000
396 47 48 1.000
397 47 49 1.000
398 47 59 1.000
399 47 107 1.000
400 47 108 1.000
401 47 109 1.000
402 48 49 1.000
403 48 50 1.000
404 48 52 1.000
405 48 53 1.000
406 48 107 1.000
407 48 108 1.000
408 48 109 1.000
409 48 110 1.000
410 48 111 1.000
411 49 50 1.000
412 49 51 1.000
413 49 52 1.000
414 49 53 1.000
415 49 109 1.000
416 49 110 1.000
417 50 51 1.000
418 50 52 1.000
419 50 53 1.000
420 51 52 1.000
421 51 53 1.000
422 52 53 1.000
423 52 110 1.000
424 52 111 1.000
425 52 112 1.000
426 52 113 1.000
427 52 116 1.000
428 53 55 1.000
429 53 116 1.000
430 55 56 1.000
431 55 57 1.000
432 55 118 1.000
433 55 119 1.000
434 55 120 1.000
435 55 121 1.000
436 55 122 1.000
437 56 57 1.000
438 56 58 1.000
439 56 122 1.000
440 57 58 1.000
441 57 59 1.000
442 57 122 1.000
443 58 59 1.000
444 58 60 1.000
445 58 107 1.000
446 59 60 1.000
447 59 61 1.000
448 59 62 1.000
449 59 63 1.000
450 60 61 1.000
451 60 62 1.000
452 60 63 1.000
453 60 66 1.000
454 60 89 1.000
455 61 62 1.000
456 61 63 1.000
457 61 64 1.000
458 61 66 1.000
459 62 63 1.000
460 62 64 1.000
461 63 64 1.000
462 63 65 1.000
463 63 66 1.000
464 64 65 1.000
465 64 66 1.000
466 65 66 1.000
467 65 67 1.000
468 65 91 1.000
469 65 92 1.000
470 66 67 1.000
471 66 68 1.000
472 66 89 1.000
473 66 90 1.000
474 66 91 1.000
475 66 92 1.000
476 67 68 1.000
477 67 69 1.000
478 67 89 1.000
479 67 90 1.000
480 67 91 1.000
481 68 69 1.000
482 68 70 1.000
483 68 88 1.000
484 68 89 1.000
485 68 90 1.000
486 69 70 1.000
487 69 71 1.000
488 69 72 1.000
489 69 87 1.000
490 69 88 1.000
491 69 89 1.000
492 69 90 1.000
493 70 71 1.000
494 70 72 1.000
495 70 88 1.000
496 71 72 1.000
497 71 73 1.000
498 71 137 1.000
499 72 73 1.000
500 72 74 1.000
501 72 87 1.000
502 72 88 1.000
503 72 135 1.000
504 72 136 1.000
505 72 137 1.000
506 72 138 1.000
507 73 74 1.000
508 73 75 1.000
509 73 85 1.000
510 73 86 1.000
511 73 87 1.000
512 73 88 1.000
513 73 135 1.000
514 73 136 1.000
515 73 137 1.000
516 74 75 1.000
517 74 76 1.000
518 74 85 1.000
519 74 86 1.000
520 74 87 1.000
521 74 88 1.000
522 74 106 1.000
523 74 134 1.000
524 74 135 1.000
525 74 136 1.000
526 75 76 1.000
527 75 77 1.000
528 75 83 1.000
529 75 84 1.000
530 75 85 1.000
531 75 86 1.000
532 75 134 1.000
533 75 135 1.000
534 76 77 1.000
535 76 78 1.000
536 76 83 1.000
537 76 84 1.000
538 76 85 1.000
539 76 134 1.000
540 77 78 1.000
541 77 79 1.000
542 77 81 1.000
543 77 82 1.000
544 77 83 1.000
545 77 84 1.000
546 78 79 1.000
547 78 80 1.000
548 78 81 1.000
549 78 82 1.000
550 78 83 1.000
551 79 80 1.000
552 79 81 1.000
553 79 82 1.000
554 79 299 1.000
555 80 81 1.000
556 80 82 1.000
557 81 82 1.000
558 81 83 1.000
559 82 83 1.000
560 82 84 1.000
561 82 112 1.000
562 82 113 1.000
563 82 114 1.000
564 82 115 1.000
565 83 84 1.000
566 83 85 1.000
567 83 111 1.000
568 83 112 1.000
569 84 85 1.000
570 84 86 1.000
571 84 108 1.000
572 84 109 1.000
573 84 110 1.000
574 84 111 1.000
575 84 112 1.000
576 85 86 1.000
577 85 87 1.000
578 85 107 1.000
579 85 108 1.000
580 85 109 1.000
581 85 110 1.000
582 85 111 1.000
583 86 87 1.000
584 86 88 1.000
585 86 106 1.000
586 86 107 1.000
587 86 108 1.000
588 86 109 1.000
589 86 110 1.000
590 87 88 1.000
591 87 89 1.000
592 87 106 1.000
593 87 107 1.000
594 87 108 1.000
595 87 109 1.000
596 88 89 1.000
597 88 90 1.000
598 88 104 1.000
599 88 105 1.000
600 88 106 1.000
601 88 107 1.000
602 88 135 1.000
603 89 90 1.000
604 89 91 1.000
605 89 104 1.000
606 89 105 1.000
607 89 106 1.000
608 89 107 1.000
609 90 91 1.000
610 90 92 1.000
611 90 101 1.000
612 90 102 1.000
613 90 103 1.000
614 90 104 1.000
615 90 105 1.000
616 91 92 1.000
617 91 93 1.000
618 91 101 1.000
619 91 102 1.000
620 91 103 1.000
621 91 104 1.000
622 91 105 1.000
623 92 93 1.000
624 92 94 1.000
625 92 99 1.000
626 92 100 1.000
627 92 101 1.000
628 92 102 1.000
629 92 103 1.000
630 93 94 1.000
631 93 95 1.000
632 93 99 1.000
633 93 100 1.000
634 93 101 1.000
635 93 102 1.000
636 93 103 1.000
637 94 95 1.000
638 94 96 1.000
639 94 97 1.000
640 94 98 1.000
641 94 99 1.000
642 94 100 1.000
643 95 96 1.000
644 95 97 1.000
645 95 98 1.000
646 95 99 1.000
647 96 97 1.000
648 96 98 1.000
649 96 169 1.000
650 97 98 1.000
651 97 99 1.000
652 98 99 1.000
653 98 100 1.000
654 98 170 1.000
655 99 100 1.000
656 99 101 1.000
657 99 147 1.000
658 100 101 1.000
659 100 102 1.000
660 100 103 1.000
661 100 143 1.000
662 100 146 1.000
663 100 147 1.000
664 101 102 1.000
665 101 103 1.000
666 102 103 1.000
667 102 104 1.000
668 103 104 1.000
669 103 105 1.000
670 103 141 1.000
671 103 142 1.000
672 103 143 1.000
673 103 146 1.000
674 104 105 1.000
675 104 106 1.000
676 104 140 1.000
677 104 141 1.000
678 104 142 1.000
679 105 106 1.000
680 105 107 1.000
681 106 107 1.000
682 106 108 1.000
683 107 108 1.000
684 107 109 1.000
685 108 109 1.000
686 108 110 1.000
687 108 111 1.000
688 109 110 1.000
689 109 111 1.000
690 110 111 1.000
691 110 112 1.000
692 111 112 1.000
693 111 113 1.000
694 111 115 1.000
695 111 116 1.000
696 112 113 1.000
697 112 114 1.000
698 112 115 1.000
699 112 116 1.000
700 113 114 1.000
701 113 115 1.000
702 113 116 1.000
703 113 117 1.000
704 114 115 1.000
705 114 116 1.000
706 114 117 1.000
707 114 118 1.000
708 115 116 1.000
709 115 117 1.000
710 115 118 1.000
711 115 119 1.000
712 115 121 1.000
713 116 117 1.000
714 116 118 1.000
715 116 119 1.000
716 117 118 1.000
717 117 119 1.000
718 118 119 1.000
719 118 120 1.000
720 118 121 1.000
721 119 120 1.000
722 119 121 1.000
723 119 122 1.000
724 120 121 1.000
725 120 122 1.000
726 121 122 1.000
727 121 123 1.000
728 121 124 1.000
729 122 123 1.000
730 122 124 1.000
731 123 124 1.000
732 123 125 1.000
733 124 125 1.000
734 124 126 1.000
735 125 126 1.000
736 125 127 1.000
737 125 143 1.000
738 126 127 1.000
739 126 128 1.000
740 126 142 1.000
741 126 143 1.000
742 127 128 1.000
743 127 129 1.000
744 127 142 1.000
745 127 143 1.000
746 127 144 1.000
747 128 129 1.000
748 128 130 1.000
749 128 132 1.000
750 128 142 1.000
751 128 192 1.000
752 128 193 1.000
753 128 194 1.000
754 129 130 1.000
755 129 131 1.000
756 129 132 1.000
757 129 133 1.000
758 129 142 1.000
759 129 189 1.000
760 129 192 1.000
761 129 193 1.000
762 129 194 1.000
763 130 131 1.000
764 130 132 1.000
765 130 133 1.000
766 130 139 1.000
767 130 140 1.000
768 130 141 1.000
769 130 142 1.000
770 130 145 1.000
771 130 192 1.000
772 131 132 1.000
773 131 133 1.000
774 131 139 1.000
775 131 192 1.000
776 132 133 1.000
777 132 134 1.000
778 132 192 1.000
779 133 134 1.000
780 133 135 1.000
781 133 139 1.000
782 133 140 1.000
783 133 141 1.000
784 133 142 1.000
785 134 135 1.000
786 134 136 1.000
787 134 139 1.000
788 134 140 1.000
789 135 136 1.000
790 135 137 1.000
791 135 138 1.000
792 135 139 1.000
793 135 140 1.000
794 136 137 1.000
795 136 138 1.000
796 136 139 1.000
797 137 138 1.000
798 137 139 1.000
799 138 139 1.000
800 138 140 1.000
801 139 140 1.000
802 139 141 1.000
803 140 141 1.000
804 140 142 1.000
805 141 142 1.000
806 141 143 1.000
807 141 144 1.000
808 141 145 1.000
809 141 146 1.000
810 142 143 1.000
811 142 144 1.000
812 142 145 1.000
813 142 146 1.000
814 143 144 1.000
815 143 145 1.000
816 143 146 1.000
817 143 147 1.000
818 144 145 1.000
819 144 146 1.000
820 144 147 1.000
821 144 148 1.000
822 144 156 1.000
823 145 146 1.000
824 145 147 1.000
825 145 148 1.000
826 146 147 1.000
827 146 148 1.000
828 146 149 1.000
829 147 148 1.000
830 147 149 1.000
831 147 150 1.000
832 147 151 1.000
833 148 149 1.000
834 148 150 1.000
835 148 151 1.000
836 148 153 1.000
837 148 154 1.000
838 148 155 1.000
839 149 150 1.000
840 149 151 1.000
841 149 154 1.000
842 150 151 1.000
843 150 152 1.000
844 151 152 1.000
845 151 153 1.000
846 151 154 1.000
847 151 155 1.000
848 151 170 1.000
849 151 171 1.000
850 152 153 1.000
851 152 154 1.000
852 152 171 1.000
853 152 172 1.000
854 153 154 1.000
855 153 155 1.000
856 153 171 1.000
857 153 172 1.000
858 154 155 1.000
859 154 156 1.000
860 154 170 1.000
861 154 171 1.000
862 154 317 1.000
863 154 318 1.000
864 154 319 1.000
865 155 156 1.000
866 155 157 1.000
867 155 170 1.000
868 155 171 1.000
869 155 172 1.000
870 155 173 1.000
871 155 315 1.000
872 155 316 1.000
873 155 317 1.000
874 155 318 1.000
875 155 319 1.000
876 156 157 1.000
877 156 158 1.000
878 156 168 1.000
879 156 169 1.000
880 156 170 1.000
881 156 171 1.000
882 156 172 1.000
883 156 173 1.000
884 156 315 1.000
885 156 316 1.000
886 156 317 1.000
887 156 318 1.000
888 157 158 1.000
889 157 159 1.000
890 157 167 1.000
891 157 168 1.000
892 157 169 1.000
893 157 170 1.000
894 157 172 1.000
895 157 173 1.000
896 157 313 1.000
897 157 314 1.000
898 157 315 1.000
899 157 316 1.000
900 158 159 1.000
901 158 160 1.000
902 158 167 1.000
903 158 168 1.000
904 158 169 1.000
905 158 309 1.000
906 158 313 1.000
907 158 314 1.000
908 158 315 1.000
909 158 316 1.000
910 159 160 1.000
911 159 161 1.000
912 159 166 1.000
913 159 167 1.000
914 159 168 1.000
915 159 177 1.000
916 159 309 1.000
917 159 310 1.000
918 159 312 1.000
919 159 313 1.000
920 159 314 1.000
921 160 161 1.000
922 160 162 1.000
923 160 165 1.000
924 160 166 1.000
925 160 167 1.000
926 160 168 1.000
927 160 306 1.000
928 160 309 1.000
929 160 310 1.000
930 160 311 1.000
931 160 312 1.000
932 160 313 1.000
933 161 162 1.000
934 161 163 1.000
935 161 164 1.000
936 161 165 1.000
937 161 166 1.000
938 161 310 1.000
939 162 163 1.000
940 162 164 1.000
941 162 165 1.000
942 162 276 1.000
943 162 310 1.000
944 162 311 1.000
945 163 164 1.000
946 163 165 1.000
947 164 165 1.000
948 164 166 1.000
949 165 166 1.000
950 165 167 1.000
951 166 167 1.000
952 166 168 1.000
953 167 168 1.000
954 167 169 1.000
955 168 169 1.000
956 168 170 1.000
957 169 170 1.000
958 169 171 1.000
959 169 172 1.000
960 169 173 1.000
961 170 171 1.000
962 170 172 1.000
963 171 172 1.000
964 171 173 1.000
965 172 173 1.000
966 172 174 1.000
967 173 174 1.000
968 173 175 1.000
969 173 315 1.000
970 174 175 1.000
971 174 176 1.000
972 174 177 1.000
973 174 178 1.000
974 175 176 1.000
975 175 177 1.000
976 175 178 1.000
977 176 177 1.000
978 176 178 1.000
979 176 179 1.000
980 177 178 1.000
981 177 179 1.000
982 177 313 1.000
983 177 329 1.000
984 178 179 1.000
985 178 180 1.000
986 178 181 1.000
987 178 312 1.000
988 178 313 1.000
989 178 327 1.000
990 178 328 1.000
991 178 329 1.000
992 179 180 1.000
993 179 181 1.000
994 179 327 1.000
995 179 328 1.000
996 179 329 1.000
997 180 181 1.000
998 180 182 1.000
999 180 327 1.000
1000 180 328 1.000
1001 181 182 1.000
1002 181 183 1.000
1003 181 327 1.000
1004 181 328 1.000
1005 182 183 1.000
1006 182 184 1.000
1007 182 325 1.000
1008 182 326 1.000
1009 182 327 1.000
1010 182 328 1.000
1011 183 184 1.000
1012 183 185 1.000
1013 183 265 1.000
1014 183 266 1.000
1015 183 268 1.000
1016 183 325 1.000
1017 183 326 1.000
1018 183 327 1.000
1019 184 185 1.000
1020 184 186 1.000
1021 184 265 1.000
1022 184 266 1.000
1023 184 323 1.000
1024 184 324 1.000
1025 184 325 1.000
1026 184 326 1.000
1027 185 186 1.000
1028 185 187 1.000
1029 185 196 1.000
1030 185 197 1.000
1031 185 265 1.000
1032 185 266 1.000
1033 185 323 1.000
1034 185 324 1.000
1035 185 325 1.000
1036 186 187 1.000
1037 186 188 1.000
1038 186 196 1.000
1039 186 197 1.000
1040 186 322 1.000
1041 186 323 1.000
1042 186 324 1.000
1043 187 188 1.000
1044 187 189 1.000
1045 187 194 1.000
1046 187 195 1.000
1047 187 196 1.000
1048 187 322 1.000
1049 187 323 1.000
1050 187 324 1.000
1051 188 189 1.000
1052 188 190 1.000
1053 188 191 1.000
1054 188 193 1.000
1055 188 194 1.000
1056 188 195 1.000
1057 188 196 1.000
1058 189 190 1.000
1059 189 191 1.000
1060 189 192 1.000
1061 189 193 1.000
1062 189 194 1.000
1063 189 195 1.000
1064 190 191 1.000
1065 190 192 1.000
1066 190 193 1.000
1067 191 192 1.000
1068 191 193 1.000
1069 191 195 1.000
1070 192 193 1.000
1071 192 194 1.000
1072 193 194 1.000
1073 193 195 1.000
1074 193 216 1.000
1075 193 217 1.000
1076 194 195 1.000
1077 194 196 1.000
1078 194 216 1.000
1079 194 217 1.000
1080 194 218 1.000
1081 194 324 1.000
1082 195 196 1.000
1083 195 197 1.000
1084 195 214 1.000
1085 195 215 1.000
1086 195 216 1.000
1087 195 217 1.000
1088 196 197 1.000
1089 196 198 1.000
1090 196 214 1.000
1091 196 215 1.000
1092 196 216 1.000
1093 196 217 1.000
1094 196 324 1.000
1095 197 198 1.000
1096 197 199 1.000
1097 197 212 1.000
1098 197 213 1.000
1099 197 214 1.000
1100 197 215 1.000
1101 197 265 1.000
1102 198 199 1.000
1103 198 200 1.000
1104 198 211 1.000
1105 198 212 1.000
1106 198 213 1.000
1107 198 214 1.000
1108 198 215 1.000
1109 198 263 1.000
1110 198 264 1.000
1111 198 265 1.000
1112 198 266 1.000
1113 199 200 1.000
1114 199 201 1.000
1115 199 210 1.000
1116 199 211 1.000
1117 199 212 1.000
1118 199 213 1.000
1119 199 263 1.000
1120 199 264 1.000
1121 199 265 1.000
1122 199 266 1.000
1123 199 267 1.000
1124 200 201 1.000
1125 200 202 1.000
1126 200 208 1.000
1127 200 209 1.000
1128 200 210 1.000
1129 200 211 1.000
1130 200 212 1.000
1131 200 213 1.000
1132 200 263 1.000
1133 200 264 1.000
1134 201 202 1.000
1135 201 203 1.000
1136 201 208 1.000
1137 201 209 1.000
1138 201 210 1.000
1139 201 211 1.000
1140 201 261 1.000
1141 201 262 1.000
1142 201 263 1.000
1143 201 264 1.000
1144 202 203 1.000
1145 202 204 1.000
1146 202 205 1.000
1147 202 206 1.000
1148 202 207 1.000
1149 202 208 1.000
1150 202 209 1.000
1151 202 261 1.000
1152 202 262 1.000
1153 202 263 1.000
1154 203 204 1.000
1155 203 205 1.000
1156 203 206 1.000
1157 203 207 1.000
1158 203 208 1.000
1159 203 233 1.000
1160 203 234 1.000
1161 203 237 1.000
1162 203 259 1.000
1163 203 260 1.000
1164 203 261 1.000
1165 203 262 1.000
1166 204 205 1.000
1167 204 206 1.000
1168 204 259 1.000
1169 204 260 1.000
1170 204 261 1.000
1171 204 262 1.000
1172 205 206 1.000
1173 205 207 1.000
1174 205 259 1.000
1175 205 260 1.000
1176 206 207 1.000
1177 206 208 1.000
1178 207 208 1.000
1179 207 209 1.000
1180 208 209 1.000
1181 208 210 1.000
1182 209 210 1.000
1183 209 211 1.000
1184 210 211 1.000
1185 210 212 1.000
1186 211 212 1.000
1187 211 213 1.000
1188 212 213 1.000
1189 212 214 1.000
1190 213 214 1.000
1191 213 215 1.000
1192 213 226 1.000
1193 213 227 1.000
1194 213 302 1.000
1195 214 215 1.000
1196 214 216 1.000
1197 214 301 1.000
1198 214 302 1.000
1199 215 216 1.000
1200 215 217 1.000
1201 215 301 1.000
1202 215 302 1.000
1203 215 303 1.000
1204 215 304 1.000
1205 216 217 1.000
1206 216 218 1.000
1207 216 301 1.000
1208 216 302 1.000
1209 216 303 1.000
1210 216 304 1.000
1211 217 218 1.000
1212 217 219 1.000
1213 217 303 1.000
1214 217 304 1.000
1215 217 305 1.000
1216 217 309 1.000
1217 218 219 1.000
1218 218 220 1.000
1219 218 221 1.000
1220 218 303 1.000
1221 218 304 1.000
1222 218 305 1.000
1223 218 306 1.000
1224 219 220 1.000
1225 219 221 1.000
1226 219 222 1.000
1227 219 305 1.000
1228 219 306 1.000
1229 219 309 1.000
1230 220 221 1.000
1231 220 222 1.000
1232 220 305 1.000
1233 220 306 1.000
1234 221 222 1.000
1235 221 223 1.000
1236 221 303 1.000
1237 221 304 1.000
1238 221 305 1.000
1239 221 306 1.000
1240 222 223 1.000
1241 222 224 1.000
1242 222 305 1.000
1243 222 306 1.000
1244 222 307 1.000
1245 223 224 1.000
1246 223 225 1.000
1247 223 292 1.000
1248 223 293 1.000
1249 223 294 1.000
1250 223 303 1.000
1251 223 304 1.000
1252 223 305 1.000
1253 223 306 1.000
1254 223 307 1.000
1255 223 308 1.000
1256 224 225 1.000
1257 224 226 1.000
1258 224 292 1.000
1259 224 293 1.000
1260 224 294 1.000
1261 224 302 1.000
1262 224 303 1.000
1263 224 304 1.000
1264 224 305 1.000
1265 224 306 1.000
1266 224 307 1.000
1267 224 308 1.000
1268 225 226 1.000
1269 225 227 1.000
1270 225 293 1.000
1271 225 294 1.000
1272 225 295 1.000
1273 225 296 1.000
1274 225 301 1.000
1275 225 302 1.000
1276 225 303 1.000
1277 225 304 1.000
1278 225 305 1.000
1279 226 227 1.000
1280 226 228 1.000
1281 226 230 1.000
1282 226 231 1.000
1283 226 293 1.000
1284 226 294 1.000
1285 226 295 1.000
1286 226 296 1.000
1287 226 297 1.000
1288 226 302 1.000
1289 226 303 1.000
1290 226 304 1.000
1291 227 228 1.000
1292 227 229 1.000
1293 227 230 1.000
1294 227 231 1.000
1295 227 295 1.000
1296 227 296 1.000
1297 227 297 1.000
1298 227 302 1.000
1299 228 229 1.000
1300 228 230 1.000
1301 228 231 1.000
1302 228 232 1.000
1303 228 294 1.000
1304 228 295 1.000
1305 228 296 1.000
1306 228 297 1.000
1307 229 230 1.000
1308 229 231 1.000
1309 229 232 1.000
1310 229 233 1.000
1311 230 231 1.000
1312 230 232 1.000
1313 230 233 1.000
1314 230 234 1.000
1315 231 232 1.000
1316 231 233 1.000
1317 231 234 1.000
1318 231 235 1.000
1319 231 293 1.000
1320 231 294 1.000
1321 231 295 1.000
1322 232 233 1.000
1323 232 234 1.000
1324 232 235 1.000
1325 232 236 1.000
1326 233 234 1.000
1327 233 235 1.000
1328 233 236 1.000
1329 233 237 1.000
1330 234 235 1.000
1331 234 236 1.000
1332 234 237 1.000
1333 234 238 1.000
1334 234 261 1.000
1335 235 236 1.000
1336 235 237 1.000
1337 235 238 1.000
1338 235 239 1.000
1339 235 241 1.000
1340 235 242 1.000
1341 235 250 1.000
1342 236 237 1.000
1343 236 238 1.000
1344 236 239 1.000
1345 236 241 1.000
1346 237 238 1.000
1347 237 239 1.000
1348 237 259 1.000
1349 238 239 1.000
1350 238 240 1.000
1351 238 241 1.000
1352 238 252 1.000
1353 238 256 1.000
1354 238 258 1.000
1355 238 259 1.000
1356 239 240 1.000
1357 239 241 1.000
1358 240 241 1.000
1359 240 242 1.000
1360 240 252 1.000
1361 240 253 1.000
1362 240 256 1.000
1363 241 242 1.000
1364 241 243 1.000
1365 241 250 1.000
1366 241 251 1.000
1367 241 252 1.000
1368 241 253 1.000
1369 242 243 1.000
1370 242 244 1.000
1371 242 250 1.000
1372 242 251 1.000
1373 242 252 1.000
1374 243 244 1.000
1375 243 245 1.000
1376 243 248 1.000
1377 243 249 1.000
1378 243 250 1.000
1379 243 251 1.000
1380 244 245 1.000
1381 244 246 1.000
1382 244 247 1.000
1383 244 248 1.000
1384 244 249 1.000
1385 244 250 1.000
1386 244 251 1.000
1387 245 246 1.000
1388 245 247 1.000
1389 245 248 1.000
1390 245 249 1.000
1391 246 247 1.000
1392 246 248 1.000
1393 247 248 1.000
1394 247 249 1.000
1395 247 251 1.000
1396 248 249 1.000
1397 248 250 1.000
1398 249 250 1.000
1399 249 251 1.000
1400 249 290 1.000
1401 249 291 1.000
1402 249 294 1.000
1403 249 295 1.000
1404 250 251 1.000
1405 250 252 1.000
1406 250 290 1.000
1407 250 291 1.000
1408 250 294 1.000
1409 251 252 1.000
1410 251 253 1.000
1411 251 288 1.000
1412 251 289 1.000
1413 251 290 1.000
1414 251 291 1.000
1415 252 253 1.000
1416 252 254 1.000
1417 252 256 1.000
1418 252 288 1.000
1419 252 289 1.000
1420 252 290 1.000
1421 252 291 1.000
1422 253 254 1.000
1423 253 255 1.000
1424 253 256 1.000
1425 253 287 1.000
1426 253 288 1.000
1427 253 289 1.000
1428 254 255 1.000
1429 254 256 1.000
1430 254 278 1.000
1431 254 280 1.000
1432 254 281 1.000
1433 254 287 1.000
1434 254 288 1.000
1435 254 289 1.000
1436 255 256 1.000
1437 255 257 1.000
1438 255 287 1.000
1439 256 257 1.000
1440 256 258 1.000
1441 257 258 1.000
1442 257 259 1.000
1443 257 274 1.000
1444 257 275 1.000
1445 258 259 1.000
1446 258 260 1.000
1447 258 274 1.000
1448 258 275 1.000
1449 258 277 1.000
1450 258 278 1.000
1451 259 260 1.000
1452 259 261 1.000
1453 259 273 1.000
1454 259 274 1.000
1455 260 261 1.000
1456 260 262 1.000
1457 260 271 1.000
1458 260 272 1.000
1459 260 273 1.000
1460 260 274 1.000
1461 260 275 1.000
1462 260 277 1.000
1463 261 262 1.000
1464 261 263 1.000
1465 261 271 1.000
1466 261 272 1.000
1467 261 273 1.000
1468 261 274 1.000
1469 262 263 1.000
1470 262 264 1.000
1471 262 269 1.000
1472 262 270 1.000
1473 262 271 1.000
1474 262 272 1.000
1475 263 264 1.000
1476 263 265 1.000
1477 263 269 1.000
1478 263 270 1.000
1479 263 271 1.000
1480 264 265 1.000
1481 264 266 1.000
1482 264 267 1.000
1483 264 268 1.000
1484 264 269 1.000
1485 264 270 1.000
1486 265 266 1.000
1487 265 267 1.000
1488 265 268 1.000
1489 265 269 1.000
1490 265 270 1.000
1491 265 326 1.000
1492 266 267 1.000
1493 266 268 1.000
1494 266 269 1.000
1495 267 268 1.000
1496 267 269 1.000
1497 268 269 1.000
1498 268 270 1.000
1499 269 270 1.000
1500 269 271 1.000
1501 270 271 1.000
1502 270 272 1.000
1503 270 311 1.000
1504 270 312 1.000
1505 270 326 1.000
1506 270 327 1.000
1507 270 328 1.000
1508 271 272 1.000
1509 271 273 1.000
1510 271 311 1.000
1511 271 328 1.000
1512 272 273 1.000
1513 272 274 1.000
1514 272 276 1.000
1515 272 277 1.000
1516 272 307 1.000
1517 272 308 1.000
1518 272 311 1.000
1519 273 274 1.000
1520 273 275 1.000
1521 273 276 1.000
1522 273 277 1.000
1523 273 311 1.000
1524 274 275 1.000
1525 274 276 1.000
1526 274 277 1.000
1527 274 278 1.000
1528 275 276 1.000
1529 275 277 1.000
1530 275 278 1.000
1531 276 277 1.000
1532 276 278 1.000
1533 276 279 1.000
1534 276 292 1.000
1535 276 307 1.000
1536 277 278 1.000
1537 277 279 1.000
1538 277 291 1.000
1539 277 292 1.000
1540 277 293 1.000
1541 277 307 1.000
1542 278 279 1.000
1543 278 280 1.000
1544 278 289 1.000
1545 278 290 1.000
1546 278 291 1.000
1547 278 292 1.000
1548 279 280 1.000
1549 279 281 1.000
1550 279 289 1.000
1551 279 290 1.000
1552 279 291 1.000
1553 279 292 1.000
1554 280 281 1.000
1555 280 282 1.000
1556 280 289 1.000
1557 280 290 1.000
1558 280 291 1.000
1559 281 282 1.000
1560 281 283 1.000
1561 281 284 1.000
1562 281 285 1.000
1563 281 286 1.000
1564 281 287 1.000
1565 281 288 1.000
1566 281 289 1.000
1567 281 290 1.000
1568 282 283 1.000
1569 282 284 1.000
1570 282 286 1.000
1571 282 288 1.000
1572 282 289 1.000
1573 282 290 1.000
1574 283 284 1.000
1575 283 285 1.000
1576 283 286 1.000
1577 284 285 1.000
1578 284 286 1.000
1579 285 286 1.000
1580 285 287 1.000
1581 286 287 1.000
1582 286 288 1.000
1583 286 289 1.000
1584 287 288 1.000
1585 287 289 1.000
1586 288 289 1.000
1587 288 290 1.000
1588 289 290 1.000
1589 289 291 1.000
1590 290 291 1.000
1591 290 292 1.000
1592 291 292 1.000
1593 291 293 1.000
1594 291 294 1.000
1595 292 293 1.000
1596 292 294 1.000
1597 292 307 1.000
1598 293 294 1.000
1599 293 295 1.000
1600 293 307 1.000
1601 294 295 1.000
1602 294 296 1.000
1603 295 296 1.000
1604 295 297 1.000
1605 295 298 1.000
1606 296 297 1.000
1607 296 298 1.000
1608 296 299 1.000
1609 296 300 1.000
1610 296 301 1.000
1611 296 302 1.000
1612 296 303 1.000
1613 297 298 1.000
1614 297 299 1.000
1615 297 300 1.000
1616 297 301 1.000
1617 298 299 1.000
1618 298 300 1.000
1619 299 300 1.000
1620 299 301 1.000
1621 299 302 1.000
1622 300 301 1.000
1623 300 302 1.000
1624 301 302 1.000
1625 301 303 1.000
1626 302 303 1.000
1627 302 304 1.000
1628 303 304 1.000
1629 303 305 1.000
1630 304 305 1.000
1631 304 306 1.000
1632 304 307 1.000
1633 304 308 1.000
1634 304 309 1.000
1635 305 306 1.000
1636 305 307 1.000
1637 305 308 1.000
1638 305 309 1.000
1639 306 307 1.000
1640 306 308 1.000
1641 306 309 1.000
1642 306 310 1.000
1643 307 308 1.000
1644 307 309 1.000
1645 307 310 1.000
1646 307 311 1.000
1647 308 309 1.000
1648 308 310 1.000
1649 308 311 1.000
1650 308 312 1.000
1651 309 310 1.000
1652 309 311 1.000
1653 309 312 1.000
1654 309 313 1.000
1655 309 314 1.000
1656 310 311 1.000
1657 310 312 1.000
1658 310 313 1.000
1659 311 312 1.000
1660 311 313 1.000
1661 311 328 1.000
1662 311 329 1.000
1663 312 313 1.000
1664 312 314 1.000
1665 312 326 1.000
1666 312 327 1.000
1667 312 328 1.000
1668 312 329 1.000
1669 313 314 1.000
1670 313 315 1.000
1671 313 326 1.000
1672 313 327 1.000
1673 313 328 1.000
1674 313 329 1.000
1675 314 315 1.000
1676 314 316 1.000
1677 314 324 1.000
1678 314 325 1.000
1679 314 326 1.000
1680 314 327 1.000
1681 315 316 1.000
1682 315 317 1.000
1683 315 324 1.000
1684 315 325 1.000
1685 315 326 1.000
1686 316 317 1.000
1687 316 318 1.000
1688 316 322 1.000
1689 316 323 1.000
1690 316 324 1.000
1691 316 325 1.000
1692 317 318 1.000
1693 317 319 1.000
1694 317 322 1.000
1695 317 323 1.000
1696 317 324 1.000
1697 317 325 1.000
1698 318 319 1.000
1699 318 320 1.000
1700 318 321 1.000
1701 318 322 1.000
1702 318 323 1.000
1703 319 320 1.000
1704 319 321 1.000
1705 319 322 1.000
1706 319 323 1.000
1707 320 321 1.000
1708 320 322 1.000
1709 321 322 1.000
1710 321 323 1.000
1711 322 323 1.000
1712 322 324 1.000
1713 323 324 1.000
1714 323 325 1.000
1715 324 325 1.000
1716 324 326 1.000
1717 325 326 1.000
1718 325 327 1.000
1719 326 327 1.000
1720 326 328 1.000
1721 327 328 1.000
1722 327 329 1.000
1723 328 329 1.000