ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1oewA_Cb_8.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 24771 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: STGSATTTPIDSLDDAYITPVQIGTPAQTLNLDFDTGSSDLWVFSSETTASEVXQTIYTPSKSTTAKLLSGATWSISYGDGSSSSGDVYTDTVSVGGLTVTGQAVESAKKVSSSFTEDSTIDGLLGLAFSTLNTVSPTQQKTFFDNAKASLDSPVFTADLGYHAPGTYNFGFIDTTAYTGSITYTAVSTKQGFWEWTSTGYAVGSGTFKSTSIDGIADTGTTLLYLPATVVSAYWAQVSGAKSSSSVGGYVFPCSATLPSFTFGVGSARIVIPGDYIDFGPISTGSSSCFGGIQSSAGIGINIFGDVALKAAFVVFNGATTPTLGFASK
3 #PDB: 1oew
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: Cb
8 #CUTOFF: 8.0
9 1 2 1.000
10 1 3 1.000
11 1 98 1.000
12 1 99 1.000
13 1 147 1.000
14 1 150 1.000
15 1 151 1.000
16 1 152 1.000
17 1 171 1.000
18 2 3 1.000
19 2 4 1.000
20 2 97 1.000
21 2 98 1.000
22 2 151 1.000
23 2 152 1.000
24 2 169 1.000
25 2 170 1.000
26 2 171 1.000
27 2 172 1.000
28 3 4 1.000
29 3 5 1.000
30 3 95 1.000
31 3 96 1.000
32 3 97 1.000
33 3 98 1.000
34 3 169 1.000
35 3 170 1.000
36 3 171 1.000
37 4 5 1.000
38 4 96 1.000
39 4 97 1.000
40 4 167 1.000
41 4 168 1.000
42 4 169 1.000
43 4 170 1.000
44 5 6 1.000
45 5 7 1.000
46 5 19 1.000
47 5 20 1.000
48 5 95 1.000
49 5 96 1.000
50 5 97 1.000
51 5 167 1.000
52 5 168 1.000
53 6 7 1.000
54 6 8 1.000
55 6 19 1.000
56 6 20 1.000
57 6 165 1.000
58 6 166 1.000
59 6 167 1.000
60 7 8 1.000
61 7 17 1.000
62 7 18 1.000
63 7 19 1.000
64 7 34 1.000
65 7 160 1.000
66 7 165 1.000
67 7 166 1.000
68 7 167 1.000
69 7 168 1.000
70 8 9 1.000
71 8 10 1.000
72 8 17 1.000
73 8 18 1.000
74 8 19 1.000
75 8 165 1.000
76 8 166 1.000
77 9 10 1.000
78 9 11 1.000
79 9 12 1.000
80 9 13 1.000
81 9 14 1.000
82 9 15 1.000
83 9 16 1.000
84 9 17 1.000
85 9 161 1.000
86 9 163 1.000
87 9 164 1.000
88 9 165 1.000
89 10 11 1.000
90 10 15 1.000
91 10 16 1.000
92 10 17 1.000
93 10 18 1.000
94 10 118 1.000
95 10 120 1.000
96 10 121 1.000
97 11 12 1.000
98 11 13 1.000
99 11 14 1.000
100 11 15 1.000
101 11 16 1.000
102 11 120 1.000
103 12 13 1.000
104 12 163 1.000
105 13 14 1.000
106 13 15 1.000
107 13 222 1.000
108 13 279 1.000
109 13 280 1.000
110 14 15 1.000
111 14 16 1.000
112 14 17 1.000
113 14 160 1.000
114 14 161 1.000
115 14 162 1.000
116 14 163 1.000
117 14 222 1.000
118 14 306 1.000
119 14 310 1.000
120 15 16 1.000
121 15 222 1.000
122 16 17 1.000
123 16 18 1.000
124 16 33 1.000
125 16 120 1.000
126 16 121 1.000
127 16 220 1.000
128 16 222 1.000
129 16 306 1.000
130 17 18 1.000
131 17 19 1.000
132 17 33 1.000
133 17 34 1.000
134 17 160 1.000
135 17 166 1.000
136 17 219 1.000
137 17 306 1.000
138 18 19 1.000
139 18 20 1.000
140 18 31 1.000
141 18 32 1.000
142 18 33 1.000
143 18 120 1.000
144 18 121 1.000
145 18 122 1.000
146 19 20 1.000
147 19 21 1.000
148 19 31 1.000
149 19 32 1.000
150 19 33 1.000
151 19 34 1.000
152 19 95 1.000
153 19 125 1.000
154 19 168 1.000
155 20 21 1.000
156 20 22 1.000
157 20 29 1.000
158 20 30 1.000
159 20 31 1.000
160 20 32 1.000
161 20 95 1.000
162 20 96 1.000
163 21 22 1.000
164 21 23 1.000
165 21 29 1.000
166 21 30 1.000
167 21 31 1.000
168 21 32 1.000
169 21 93 1.000
170 21 94 1.000
171 21 95 1.000
172 21 125 1.000
173 22 23 1.000
174 22 24 1.000
175 22 27 1.000
176 22 28 1.000
177 22 29 1.000
178 22 93 1.000
179 22 94 1.000
180 22 95 1.000
181 22 97 1.000
182 23 24 1.000
183 23 27 1.000
184 23 28 1.000
185 23 29 1.000
186 23 30 1.000
187 23 43 1.000
188 23 58 1.000
189 23 63 1.000
190 23 91 1.000
191 23 92 1.000
192 23 93 1.000
193 23 105 1.000
194 24 25 1.000
195 24 26 1.000
196 24 27 1.000
197 24 28 1.000
198 24 63 1.000
199 24 64 1.000
200 24 65 1.000
201 24 66 1.000
202 24 91 1.000
203 24 92 1.000
204 24 93 1.000
205 25 26 1.000
206 25 27 1.000
207 25 63 1.000
208 25 64 1.000
209 25 65 1.000
210 25 91 1.000
211 25 92 1.000
212 26 27 1.000
213 26 28 1.000
214 26 62 1.000
215 26 63 1.000
216 27 28 1.000
217 27 29 1.000
218 27 94 1.000
219 28 29 1.000
220 28 30 1.000
221 28 56 1.000
222 28 58 1.000
223 28 59 1.000
224 28 62 1.000
225 28 63 1.000
226 29 30 1.000
227 29 31 1.000
228 29 56 1.000
229 30 31 1.000
230 30 32 1.000
231 30 43 1.000
232 30 44 1.000
233 30 56 1.000
234 30 57 1.000
235 30 58 1.000
236 30 122 1.000
237 30 123 1.000
238 31 32 1.000
239 31 56 1.000
240 31 120 1.000
241 31 121 1.000
242 31 122 1.000
243 32 33 1.000
244 32 34 1.000
245 32 41 1.000
246 32 43 1.000
247 32 121 1.000
248 32 122 1.000
249 32 123 1.000
250 32 124 1.000
251 32 125 1.000
252 33 34 1.000
253 33 35 1.000
254 33 121 1.000
255 33 123 1.000
256 33 124 1.000
257 33 125 1.000
258 33 220 1.000
259 34 35 1.000
260 34 36 1.000
261 34 124 1.000
262 34 125 1.000
263 34 126 1.000
264 34 127 1.000
265 34 158 1.000
266 34 168 1.000
267 34 219 1.000
268 34 220 1.000
269 35 36 1.000
270 35 37 1.000
271 35 38 1.000
272 35 124 1.000
273 35 125 1.000
274 35 126 1.000
275 35 127 1.000
276 35 128 1.000
277 35 218 1.000
278 35 219 1.000
279 35 220 1.000
280 36 37 1.000
281 36 126 1.000
282 36 127 1.000
283 36 128 1.000
284 36 158 1.000
285 36 194 1.000
286 36 217 1.000
287 36 218 1.000
288 36 219 1.000
289 36 220 1.000
290 36 316 1.000
291 37 38 1.000
292 37 39 1.000
293 37 126 1.000
294 37 127 1.000
295 37 128 1.000
296 37 132 1.000
297 37 193 1.000
298 37 194 1.000
299 37 216 1.000
300 37 218 1.000
301 37 219 1.000
302 37 220 1.000
303 37 221 1.000
304 38 39 1.000
305 38 40 1.000
306 38 76 1.000
307 38 78 1.000
308 38 124 1.000
309 38 126 1.000
310 38 128 1.000
311 38 132 1.000
312 38 220 1.000
313 39 40 1.000
314 39 126 1.000
315 39 127 1.000
316 39 128 1.000
317 39 129 1.000
318 39 130 1.000
319 39 131 1.000
320 39 132 1.000
321 39 133 1.000
322 39 134 1.000
323 39 142 1.000
324 39 192 1.000
325 40 41 1.000
326 40 42 1.000
327 40 74 1.000
328 40 76 1.000
329 40 106 1.000
330 40 124 1.000
331 40 126 1.000
332 40 133 1.000
333 40 134 1.000
334 40 135 1.000
335 40 140 1.000
336 41 42 1.000
337 41 43 1.000
338 41 93 1.000
339 41 103 1.000
340 41 104 1.000
341 41 105 1.000
342 41 106 1.000
343 41 124 1.000
344 41 125 1.000
345 41 126 1.000
346 41 142 1.000
347 41 143 1.000
348 42 43 1.000
349 42 74 1.000
350 42 76 1.000
351 42 84 1.000
352 42 86 1.000
353 42 105 1.000
354 42 106 1.000
355 42 107 1.000
356 42 108 1.000
357 42 123 1.000
358 42 124 1.000
359 43 44 1.000
360 43 45 1.000
361 43 57 1.000
362 43 58 1.000
363 43 105 1.000
364 43 106 1.000
365 43 107 1.000
366 43 108 1.000
367 43 122 1.000
368 43 123 1.000
369 44 45 1.000
370 44 48 1.000
371 44 53 1.000
372 44 55 1.000
373 44 56 1.000
374 44 57 1.000
375 44 58 1.000
376 44 108 1.000
377 44 111 1.000
378 44 115 1.000
379 44 122 1.000
380 44 123 1.000
381 45 46 1.000
382 45 47 1.000
383 45 48 1.000
384 45 57 1.000
385 45 58 1.000
386 45 59 1.000
387 45 60 1.000
388 45 107 1.000
389 45 108 1.000
390 46 47 1.000
391 46 48 1.000
392 46 57 1.000
393 46 58 1.000
394 46 59 1.000
395 46 60 1.000
396 46 61 1.000
397 47 48 1.000
398 47 60 1.000
399 47 86 1.000
400 47 87 1.000
401 47 107 1.000
402 47 108 1.000
403 47 109 1.000
404 48 49 1.000
405 48 50 1.000
406 48 52 1.000
407 48 53 1.000
408 48 57 1.000
409 48 107 1.000
410 48 108 1.000
411 48 109 1.000
412 48 110 1.000
413 48 111 1.000
414 49 50 1.000
415 49 51 1.000
416 49 52 1.000
417 49 53 1.000
418 49 109 1.000
419 49 110 1.000
420 49 111 1.000
421 50 51 1.000
422 50 52 1.000
423 50 53 1.000
424 51 52 1.000
425 51 53 1.000
426 52 53 1.000
427 52 110 1.000
428 52 111 1.000
429 52 115 1.000
430 52 116 1.000
431 53 55 1.000
432 53 57 1.000
433 53 111 1.000
434 53 116 1.000
435 55 56 1.000
436 55 57 1.000
437 55 119 1.000
438 55 121 1.000
439 55 122 1.000
440 55 123 1.000
441 56 57 1.000
442 56 122 1.000
443 57 58 1.000
444 57 59 1.000
445 57 122 1.000
446 58 59 1.000
447 58 60 1.000
448 58 105 1.000
449 58 107 1.000
450 58 122 1.000
451 59 60 1.000
452 59 61 1.000
453 59 62 1.000
454 59 63 1.000
455 60 61 1.000
456 60 62 1.000
457 60 63 1.000
458 60 66 1.000
459 60 68 1.000
460 60 89 1.000
461 60 91 1.000
462 60 105 1.000
463 60 107 1.000
464 61 62 1.000
465 61 63 1.000
466 61 66 1.000
467 62 63 1.000
468 63 64 1.000
469 63 65 1.000
470 63 66 1.000
471 63 89 1.000
472 63 91 1.000
473 63 92 1.000
474 64 65 1.000
475 64 66 1.000
476 65 66 1.000
477 65 67 1.000
478 65 91 1.000
479 65 92 1.000
480 65 101 1.000
481 66 67 1.000
482 66 68 1.000
483 66 89 1.000
484 66 90 1.000
485 66 91 1.000
486 66 105 1.000
487 67 68 1.000
488 67 69 1.000
489 67 89 1.000
490 67 90 1.000
491 67 91 1.000
492 67 102 1.000
493 68 69 1.000
494 68 70 1.000
495 68 87 1.000
496 68 88 1.000
497 68 89 1.000
498 69 70 1.000
499 69 71 1.000
500 69 72 1.000
501 69 87 1.000
502 69 88 1.000
503 69 89 1.000
504 69 90 1.000
505 69 104 1.000
506 69 135 1.000
507 69 140 1.000
508 70 71 1.000
509 70 72 1.000
510 71 72 1.000
511 71 73 1.000
512 71 87 1.000
513 71 137 1.000
514 72 73 1.000
515 72 74 1.000
516 72 87 1.000
517 72 88 1.000
518 72 135 1.000
519 72 136 1.000
520 72 137 1.000
521 72 138 1.000
522 72 140 1.000
523 73 74 1.000
524 73 75 1.000
525 73 85 1.000
526 73 86 1.000
527 73 87 1.000
528 73 88 1.000
529 73 135 1.000
530 73 136 1.000
531 74 75 1.000
532 74 76 1.000
533 74 85 1.000
534 74 86 1.000
535 74 87 1.000
536 74 88 1.000
537 74 106 1.000
538 74 134 1.000
539 74 135 1.000
540 74 136 1.000
541 75 76 1.000
542 75 77 1.000
543 75 83 1.000
544 75 84 1.000
545 75 85 1.000
546 75 86 1.000
547 75 134 1.000
548 76 77 1.000
549 76 78 1.000
550 76 83 1.000
551 76 84 1.000
552 76 85 1.000
553 76 134 1.000
554 77 78 1.000
555 77 79 1.000
556 77 81 1.000
557 77 82 1.000
558 77 83 1.000
559 78 79 1.000
560 78 80 1.000
561 78 81 1.000
562 78 82 1.000
563 78 83 1.000
564 79 80 1.000
565 79 81 1.000
566 79 82 1.000
567 79 299 1.000
568 80 81 1.000
569 80 82 1.000
570 80 114 1.000
571 81 82 1.000
572 81 83 1.000
573 81 112 1.000
574 81 114 1.000
575 82 83 1.000
576 82 84 1.000
577 82 112 1.000
578 82 114 1.000
579 82 115 1.000
580 83 84 1.000
581 83 85 1.000
582 83 111 1.000
583 83 112 1.000
584 84 85 1.000
585 84 86 1.000
586 84 108 1.000
587 84 110 1.000
588 84 111 1.000
589 84 112 1.000
590 84 115 1.000
591 85 86 1.000
592 85 108 1.000
593 85 109 1.000
594 85 110 1.000
595 86 87 1.000
596 86 88 1.000
597 86 106 1.000
598 86 107 1.000
599 86 108 1.000
600 86 109 1.000
601 86 110 1.000
602 87 88 1.000
603 87 89 1.000
604 87 106 1.000
605 87 107 1.000
606 87 109 1.000
607 88 89 1.000
608 88 90 1.000
609 88 104 1.000
610 88 105 1.000
611 88 106 1.000
612 88 107 1.000
613 88 135 1.000
614 88 140 1.000
615 89 90 1.000
616 89 91 1.000
617 89 104 1.000
618 89 105 1.000
619 89 106 1.000
620 89 107 1.000
621 90 91 1.000
622 90 102 1.000
623 90 103 1.000
624 90 104 1.000
625 90 105 1.000
626 91 92 1.000
627 91 93 1.000
628 91 102 1.000
629 91 103 1.000
630 91 105 1.000
631 92 93 1.000
632 92 94 1.000
633 92 99 1.000
634 92 100 1.000
635 92 101 1.000
636 92 102 1.000
637 92 103 1.000
638 93 94 1.000
639 93 95 1.000
640 93 99 1.000
641 93 100 1.000
642 93 102 1.000
643 93 103 1.000
644 93 105 1.000
645 93 143 1.000
646 94 95 1.000
647 94 96 1.000
648 94 97 1.000
649 94 98 1.000
650 94 99 1.000
651 94 100 1.000
652 95 96 1.000
653 95 97 1.000
654 95 98 1.000
655 95 125 1.000
656 95 143 1.000
657 95 168 1.000
658 95 170 1.000
659 96 97 1.000
660 96 98 1.000
661 96 170 1.000
662 97 98 1.000
663 97 99 1.000
664 98 99 1.000
665 98 100 1.000
666 98 147 1.000
667 98 150 1.000
668 98 151 1.000
669 98 170 1.000
670 98 171 1.000
671 99 100 1.000
672 99 101 1.000
673 100 101 1.000
674 100 102 1.000
675 100 103 1.000
676 100 143 1.000
677 100 146 1.000
678 100 147 1.000
679 100 150 1.000
680 101 102 1.000
681 101 103 1.000
682 102 103 1.000
683 102 104 1.000
684 102 146 1.000
685 103 104 1.000
686 103 105 1.000
687 103 143 1.000
688 103 146 1.000
689 104 105 1.000
690 104 106 1.000
691 104 133 1.000
692 104 135 1.000
693 104 140 1.000
694 104 141 1.000
695 105 106 1.000
696 105 107 1.000
697 106 107 1.000
698 106 108 1.000
699 106 135 1.000
700 106 140 1.000
701 107 108 1.000
702 107 109 1.000
703 108 109 1.000
704 108 110 1.000
705 108 111 1.000
706 108 123 1.000
707 109 110 1.000
708 110 111 1.000
709 110 112 1.000
710 111 112 1.000
711 111 115 1.000
712 111 116 1.000
713 112 113 1.000
714 112 114 1.000
715 112 115 1.000
716 112 116 1.000
717 113 114 1.000
718 113 115 1.000
719 113 116 1.000
720 113 117 1.000
721 114 115 1.000
722 114 116 1.000
723 114 117 1.000
724 114 118 1.000
725 115 116 1.000
726 115 117 1.000
727 115 118 1.000
728 115 121 1.000
729 115 123 1.000
730 116 117 1.000
731 116 118 1.000
732 117 118 1.000
733 118 119 1.000
734 118 120 1.000
735 118 121 1.000
736 119 120 1.000
737 119 121 1.000
738 120 121 1.000
739 121 122 1.000
740 121 123 1.000
741 121 124 1.000
742 122 123 1.000
743 123 124 1.000
744 123 125 1.000
745 124 125 1.000
746 124 126 1.000
747 125 126 1.000
748 125 127 1.000
749 125 143 1.000
750 126 127 1.000
751 126 128 1.000
752 126 142 1.000
753 126 143 1.000
754 127 128 1.000
755 127 142 1.000
756 127 143 1.000
757 127 144 1.000
758 127 156 1.000
759 127 219 1.000
760 127 316 1.000
761 128 129 1.000
762 128 132 1.000
763 128 142 1.000
764 128 192 1.000
765 128 193 1.000
766 128 194 1.000
767 129 130 1.000
768 129 131 1.000
769 129 132 1.000
770 129 142 1.000
771 129 189 1.000
772 129 192 1.000
773 129 193 1.000
774 129 194 1.000
775 129 322 1.000
776 130 131 1.000
777 130 132 1.000
778 130 133 1.000
779 130 139 1.000
780 130 140 1.000
781 130 141 1.000
782 130 142 1.000
783 130 145 1.000
784 131 132 1.000
785 131 133 1.000
786 131 139 1.000
787 131 189 1.000
788 131 192 1.000
789 132 133 1.000
790 132 134 1.000
791 132 192 1.000
792 132 193 1.000
793 133 134 1.000
794 133 135 1.000
795 133 139 1.000
796 133 140 1.000
797 133 141 1.000
798 133 142 1.000
799 134 135 1.000
800 134 136 1.000
801 134 139 1.000
802 135 136 1.000
803 135 138 1.000
804 135 139 1.000
805 135 140 1.000
806 136 137 1.000
807 136 138 1.000
808 136 139 1.000
809 137 138 1.000
810 138 139 1.000
811 138 140 1.000
812 139 140 1.000
813 139 141 1.000
814 140 141 1.000
815 141 142 1.000
816 141 145 1.000
817 141 146 1.000
818 142 143 1.000
819 142 144 1.000
820 142 145 1.000
821 142 146 1.000
822 143 144 1.000
823 143 145 1.000
824 143 146 1.000
825 143 147 1.000
826 144 145 1.000
827 144 146 1.000
828 144 147 1.000
829 144 148 1.000
830 144 156 1.000
831 144 170 1.000
832 144 316 1.000
833 144 318 1.000
834 145 146 1.000
835 145 147 1.000
836 145 148 1.000
837 146 147 1.000
838 146 148 1.000
839 146 149 1.000
840 147 148 1.000
841 147 149 1.000
842 147 150 1.000
843 147 151 1.000
844 147 170 1.000
845 147 171 1.000
846 148 149 1.000
847 148 150 1.000
848 148 151 1.000
849 148 154 1.000
850 148 318 1.000
851 149 150 1.000
852 149 151 1.000
853 150 151 1.000
854 151 152 1.000
855 151 153 1.000
856 151 154 1.000
857 151 155 1.000
858 151 170 1.000
859 151 171 1.000
860 152 153 1.000
861 152 171 1.000
862 152 172 1.000
863 153 154 1.000
864 153 155 1.000
865 153 171 1.000
866 153 172 1.000
867 153 173 1.000
868 154 155 1.000
869 154 171 1.000
870 154 317 1.000
871 154 318 1.000
872 154 319 1.000
873 155 156 1.000
874 155 157 1.000
875 155 170 1.000
876 155 171 1.000
877 155 172 1.000
878 155 173 1.000
879 155 315 1.000
880 155 316 1.000
881 155 317 1.000
882 155 318 1.000
883 155 319 1.000
884 156 157 1.000
885 156 158 1.000
886 156 168 1.000
887 156 169 1.000
888 156 170 1.000
889 156 171 1.000
890 156 316 1.000
891 157 158 1.000
892 157 159 1.000
893 157 167 1.000
894 157 168 1.000
895 157 169 1.000
896 157 173 1.000
897 157 174 1.000
898 157 177 1.000
899 157 313 1.000
900 157 314 1.000
901 157 315 1.000
902 157 316 1.000
903 158 159 1.000
904 158 160 1.000
905 158 168 1.000
906 158 219 1.000
907 158 309 1.000
908 158 313 1.000
909 158 314 1.000
910 158 316 1.000
911 159 160 1.000
912 159 161 1.000
913 159 166 1.000
914 159 167 1.000
915 159 168 1.000
916 159 169 1.000
917 159 174 1.000
918 159 177 1.000
919 159 178 1.000
920 159 313 1.000
921 159 314 1.000
922 159 329 1.000
923 160 161 1.000
924 160 162 1.000
925 160 166 1.000
926 160 219 1.000
927 160 306 1.000
928 160 309 1.000
929 160 310 1.000
930 161 162 1.000
931 161 163 1.000
932 161 164 1.000
933 161 165 1.000
934 161 166 1.000
935 161 310 1.000
936 162 163 1.000
937 162 164 1.000
938 162 273 1.000
939 162 275 1.000
940 162 276 1.000
941 162 310 1.000
942 162 311 1.000
943 163 164 1.000
944 164 165 1.000
945 164 166 1.000
946 165 166 1.000
947 165 167 1.000
948 166 167 1.000
949 166 168 1.000
950 167 168 1.000
951 167 169 1.000
952 167 174 1.000
953 167 177 1.000
954 168 169 1.000
955 168 170 1.000
956 169 170 1.000
957 169 171 1.000
958 169 172 1.000
959 169 173 1.000
960 169 174 1.000
961 170 171 1.000
962 170 172 1.000
963 171 172 1.000
964 171 173 1.000
965 172 173 1.000
966 172 174 1.000
967 173 174 1.000
968 173 175 1.000
969 173 182 1.000
970 173 315 1.000
971 174 175 1.000
972 174 176 1.000
973 174 177 1.000
974 174 178 1.000
975 175 176 1.000
976 175 177 1.000
977 175 178 1.000
978 176 177 1.000
979 177 178 1.000
980 177 313 1.000
981 177 329 1.000
982 178 179 1.000
983 178 180 1.000
984 178 182 1.000
985 178 312 1.000
986 178 313 1.000
987 178 327 1.000
988 178 328 1.000
989 178 329 1.000
990 179 180 1.000
991 179 327 1.000
992 179 328 1.000
993 179 329 1.000
994 180 181 1.000
995 180 327 1.000
996 180 328 1.000
997 181 182 1.000
998 181 183 1.000
999 181 327 1.000
1000 182 183 1.000
1001 182 184 1.000
1002 182 313 1.000
1003 182 315 1.000
1004 182 325 1.000
1005 182 326 1.000
1006 182 327 1.000
1007 183 184 1.000
1008 183 185 1.000
1009 183 265 1.000
1010 183 266 1.000
1011 183 267 1.000
1012 183 268 1.000
1013 183 325 1.000
1014 183 326 1.000
1015 183 327 1.000
1016 184 185 1.000
1017 184 315 1.000
1018 184 317 1.000
1019 184 323 1.000
1020 184 324 1.000
1021 184 325 1.000
1022 185 186 1.000
1023 185 187 1.000
1024 185 196 1.000
1025 185 197 1.000
1026 185 265 1.000
1027 185 266 1.000
1028 185 323 1.000
1029 185 324 1.000
1030 185 325 1.000
1031 185 326 1.000
1032 186 187 1.000
1033 186 188 1.000
1034 186 196 1.000
1035 186 197 1.000
1036 186 323 1.000
1037 186 324 1.000
1038 187 188 1.000
1039 187 189 1.000
1040 187 194 1.000
1041 187 195 1.000
1042 187 196 1.000
1043 187 322 1.000
1044 187 323 1.000
1045 187 324 1.000
1046 188 189 1.000
1047 188 190 1.000
1048 188 191 1.000
1049 188 195 1.000
1050 188 196 1.000
1051 189 190 1.000
1052 189 191 1.000
1053 189 192 1.000
1054 189 193 1.000
1055 189 195 1.000
1056 189 322 1.000
1057 190 191 1.000
1058 190 192 1.000
1059 190 195 1.000
1060 191 192 1.000
1061 191 193 1.000
1062 191 195 1.000
1063 191 216 1.000
1064 192 193 1.000
1065 192 195 1.000
1066 193 194 1.000
1067 193 195 1.000
1068 193 215 1.000
1069 193 216 1.000
1070 193 217 1.000
1071 193 218 1.000
1072 194 195 1.000
1073 194 196 1.000
1074 194 216 1.000
1075 194 217 1.000
1076 194 218 1.000
1077 194 316 1.000
1078 194 322 1.000
1079 194 324 1.000
1080 195 196 1.000
1081 195 214 1.000
1082 195 215 1.000
1083 195 216 1.000
1084 196 197 1.000
1085 196 198 1.000
1086 196 214 1.000
1087 196 215 1.000
1088 196 216 1.000
1089 196 217 1.000
1090 196 324 1.000
1091 197 198 1.000
1092 197 199 1.000
1093 197 212 1.000
1094 197 213 1.000
1095 197 214 1.000
1096 197 215 1.000
1097 198 199 1.000
1098 198 200 1.000
1099 198 201 1.000
1100 198 212 1.000
1101 198 213 1.000
1102 198 214 1.000
1103 198 215 1.000
1104 198 263 1.000
1105 198 264 1.000
1106 198 265 1.000
1107 198 304 1.000
1108 199 200 1.000
1109 199 210 1.000
1110 199 212 1.000
1111 199 264 1.000
1112 199 265 1.000
1113 199 266 1.000
1114 199 267 1.000
1115 200 201 1.000
1116 200 202 1.000
1117 200 208 1.000
1118 200 209 1.000
1119 200 210 1.000
1120 200 211 1.000
1121 200 212 1.000
1122 200 213 1.000
1123 200 263 1.000
1124 200 264 1.000
1125 201 202 1.000
1126 201 203 1.000
1127 201 208 1.000
1128 201 209 1.000
1129 201 211 1.000
1130 201 213 1.000
1131 201 226 1.000
1132 201 230 1.000
1133 201 261 1.000
1134 201 262 1.000
1135 201 263 1.000
1136 201 264 1.000
1137 202 203 1.000
1138 202 204 1.000
1139 202 206 1.000
1140 202 207 1.000
1141 202 208 1.000
1142 202 209 1.000
1143 202 261 1.000
1144 202 262 1.000
1145 202 269 1.000
1146 203 204 1.000
1147 203 206 1.000
1148 203 233 1.000
1149 203 234 1.000
1150 203 236 1.000
1151 203 237 1.000
1152 203 259 1.000
1153 203 260 1.000
1154 203 261 1.000
1155 203 262 1.000
1156 204 205 1.000
1157 204 206 1.000
1158 204 237 1.000
1159 204 259 1.000
1160 204 260 1.000
1161 204 261 1.000
1162 204 262 1.000
1163 205 206 1.000
1164 205 259 1.000
1165 206 207 1.000
1166 206 208 1.000
1167 207 208 1.000
1168 207 209 1.000
1169 208 209 1.000
1170 208 210 1.000
1171 208 262 1.000
1172 208 264 1.000
1173 208 269 1.000
1174 209 210 1.000
1175 209 211 1.000
1176 210 211 1.000
1177 211 212 1.000
1178 211 213 1.000
1179 211 230 1.000
1180 212 213 1.000
1181 212 214 1.000
1182 213 214 1.000
1183 213 215 1.000
1184 213 226 1.000
1185 213 227 1.000
1186 213 230 1.000
1187 213 263 1.000
1188 213 302 1.000
1189 214 215 1.000
1190 214 301 1.000
1191 214 302 1.000
1192 215 216 1.000
1193 215 217 1.000
1194 215 301 1.000
1195 215 302 1.000
1196 215 303 1.000
1197 215 304 1.000
1198 216 217 1.000
1199 216 218 1.000
1200 216 301 1.000
1201 216 302 1.000
1202 216 303 1.000
1203 216 304 1.000
1204 217 218 1.000
1205 217 219 1.000
1206 217 304 1.000
1207 217 305 1.000
1208 217 309 1.000
1209 217 314 1.000
1210 217 316 1.000
1211 217 324 1.000
1212 218 219 1.000
1213 218 220 1.000
1214 218 221 1.000
1215 218 303 1.000
1216 218 304 1.000
1217 218 305 1.000
1218 218 309 1.000
1219 219 220 1.000
1220 219 221 1.000
1221 219 305 1.000
1222 219 306 1.000
1223 219 309 1.000
1224 220 221 1.000
1225 220 222 1.000
1226 220 305 1.000
1227 220 306 1.000
1228 221 222 1.000
1229 221 223 1.000
1230 221 225 1.000
1231 221 303 1.000
1232 221 305 1.000
1233 221 306 1.000
1234 222 223 1.000
1235 222 279 1.000
1236 222 305 1.000
1237 222 306 1.000
1238 222 307 1.000
1239 223 224 1.000
1240 223 225 1.000
1241 223 279 1.000
1242 223 291 1.000
1243 223 292 1.000
1244 223 293 1.000
1245 223 294 1.000
1246 223 303 1.000
1247 223 305 1.000
1248 223 306 1.000
1249 223 307 1.000
1250 224 225 1.000
1251 224 226 1.000
1252 224 261 1.000
1253 224 272 1.000
1254 224 277 1.000
1255 224 292 1.000
1256 224 293 1.000
1257 224 294 1.000
1258 224 303 1.000
1259 224 304 1.000
1260 224 305 1.000
1261 224 307 1.000
1262 224 308 1.000
1263 225 226 1.000
1264 225 293 1.000
1265 225 294 1.000
1266 225 295 1.000
1267 225 296 1.000
1268 225 299 1.000
1269 225 301 1.000
1270 225 302 1.000
1271 225 303 1.000
1272 225 305 1.000
1273 226 227 1.000
1274 226 230 1.000
1275 226 231 1.000
1276 226 293 1.000
1277 226 294 1.000
1278 226 295 1.000
1279 226 296 1.000
1280 226 302 1.000
1281 227 228 1.000
1282 227 229 1.000
1283 227 230 1.000
1284 227 231 1.000
1285 227 295 1.000
1286 227 296 1.000
1287 227 297 1.000
1288 227 302 1.000
1289 228 229 1.000
1290 228 230 1.000
1291 228 231 1.000
1292 228 232 1.000
1293 228 295 1.000
1294 228 296 1.000
1295 228 297 1.000
1296 229 230 1.000
1297 229 231 1.000
1298 229 232 1.000
1299 229 233 1.000
1300 230 231 1.000
1301 230 232 1.000
1302 230 233 1.000
1303 230 234 1.000
1304 231 232 1.000
1305 231 233 1.000
1306 231 234 1.000
1307 231 235 1.000
1308 231 250 1.000
1309 231 293 1.000
1310 231 294 1.000
1311 231 295 1.000
1312 231 296 1.000
1313 232 233 1.000
1314 232 234 1.000
1315 232 235 1.000
1316 232 236 1.000
1317 233 234 1.000
1318 233 235 1.000
1319 233 236 1.000
1320 233 237 1.000
1321 234 235 1.000
1322 234 236 1.000
1323 234 237 1.000
1324 234 238 1.000
1325 234 259 1.000
1326 234 261 1.000
1327 234 277 1.000
1328 234 293 1.000
1329 235 236 1.000
1330 235 237 1.000
1331 235 238 1.000
1332 235 241 1.000
1333 235 242 1.000
1334 235 243 1.000
1335 235 250 1.000
1336 235 252 1.000
1337 235 293 1.000
1338 236 237 1.000
1339 236 238 1.000
1340 237 238 1.000
1341 237 259 1.000
1342 238 239 1.000
1343 238 240 1.000
1344 238 241 1.000
1345 238 252 1.000
1346 238 256 1.000
1347 238 258 1.000
1348 238 259 1.000
1349 239 240 1.000
1350 239 241 1.000
1351 239 256 1.000
1352 240 241 1.000
1353 240 242 1.000
1354 240 252 1.000
1355 240 253 1.000
1356 240 256 1.000
1357 241 242 1.000
1358 241 250 1.000
1359 241 251 1.000
1360 241 252 1.000
1361 241 256 1.000
1362 241 291 1.000
1363 242 243 1.000
1364 242 244 1.000
1365 242 250 1.000
1366 242 251 1.000
1367 242 252 1.000
1368 243 244 1.000
1369 243 245 1.000
1370 243 248 1.000
1371 243 249 1.000
1372 243 250 1.000
1373 243 251 1.000
1374 244 245 1.000
1375 244 246 1.000
1376 244 247 1.000
1377 244 248 1.000
1378 244 249 1.000
1379 244 250 1.000
1380 244 251 1.000
1381 245 246 1.000
1382 245 247 1.000
1383 245 248 1.000
1384 246 247 1.000
1385 246 248 1.000
1386 247 248 1.000
1387 247 249 1.000
1388 247 251 1.000
1389 247 282 1.000
1390 247 288 1.000
1391 247 290 1.000
1392 248 249 1.000
1393 249 250 1.000
1394 249 251 1.000
1395 249 290 1.000
1396 249 291 1.000
1397 249 294 1.000
1398 249 295 1.000
1399 250 251 1.000
1400 250 252 1.000
1401 250 290 1.000
1402 250 291 1.000
1403 250 293 1.000
1404 250 294 1.000
1405 251 252 1.000
1406 251 282 1.000
1407 251 288 1.000
1408 251 289 1.000
1409 251 290 1.000
1410 251 291 1.000
1411 252 253 1.000
1412 252 254 1.000
1413 252 256 1.000
1414 252 258 1.000
1415 252 288 1.000
1416 252 289 1.000
1417 252 291 1.000
1418 253 254 1.000
1419 253 255 1.000
1420 253 256 1.000
1421 253 287 1.000
1422 253 288 1.000
1423 253 289 1.000
1424 254 255 1.000
1425 254 256 1.000
1426 254 278 1.000
1427 254 280 1.000
1428 254 281 1.000
1429 254 286 1.000
1430 254 287 1.000
1431 254 288 1.000
1432 254 289 1.000
1433 255 256 1.000
1434 255 287 1.000
1435 256 257 1.000
1436 256 258 1.000
1437 256 278 1.000
1438 256 289 1.000
1439 257 258 1.000
1440 257 274 1.000
1441 258 259 1.000
1442 258 260 1.000
1443 258 274 1.000
1444 258 275 1.000
1445 258 277 1.000
1446 258 278 1.000
1447 259 260 1.000
1448 259 261 1.000
1449 259 274 1.000
1450 260 261 1.000
1451 260 262 1.000
1452 260 271 1.000
1453 260 272 1.000
1454 260 273 1.000
1455 260 274 1.000
1456 260 277 1.000
1457 261 262 1.000
1458 261 263 1.000
1459 261 271 1.000
1460 261 272 1.000
1461 261 274 1.000
1462 261 277 1.000
1463 261 293 1.000
1464 262 263 1.000
1465 262 264 1.000
1466 262 269 1.000
1467 262 270 1.000
1468 262 271 1.000
1469 262 272 1.000
1470 263 264 1.000
1471 263 265 1.000
1472 263 269 1.000
1473 263 270 1.000
1474 263 272 1.000
1475 263 304 1.000
1476 263 308 1.000
1477 264 265 1.000
1478 264 266 1.000
1479 264 268 1.000
1480 264 269 1.000
1481 264 270 1.000
1482 265 266 1.000
1483 265 268 1.000
1484 265 269 1.000
1485 265 270 1.000
1486 265 325 1.000
1487 265 326 1.000
1488 266 267 1.000
1489 266 268 1.000
1490 267 268 1.000
1491 268 269 1.000
1492 268 270 1.000
1493 268 326 1.000
1494 269 270 1.000
1495 269 271 1.000
1496 270 271 1.000
1497 270 272 1.000
1498 270 308 1.000
1499 270 311 1.000
1500 270 312 1.000
1501 270 326 1.000
1502 270 328 1.000
1503 271 272 1.000
1504 271 273 1.000
1505 271 311 1.000
1506 271 328 1.000
1507 272 273 1.000
1508 272 274 1.000
1509 272 276 1.000
1510 272 277 1.000
1511 272 307 1.000
1512 272 308 1.000
1513 272 311 1.000
1514 273 274 1.000
1515 273 275 1.000
1516 273 276 1.000
1517 273 277 1.000
1518 273 311 1.000
1519 274 275 1.000
1520 274 276 1.000
1521 274 277 1.000
1522 274 278 1.000
1523 275 276 1.000
1524 275 277 1.000
1525 275 278 1.000
1526 276 277 1.000
1527 276 278 1.000
1528 276 292 1.000
1529 276 307 1.000
1530 276 310 1.000
1531 276 311 1.000
1532 277 278 1.000
1533 277 279 1.000
1534 277 291 1.000
1535 277 292 1.000
1536 277 293 1.000
1537 277 307 1.000
1538 278 279 1.000
1539 278 280 1.000
1540 278 289 1.000
1541 278 291 1.000
1542 278 292 1.000
1543 279 280 1.000
1544 279 289 1.000
1545 279 290 1.000
1546 279 291 1.000
1547 279 292 1.000
1548 279 307 1.000
1549 280 281 1.000
1550 280 282 1.000
1551 280 289 1.000
1552 280 290 1.000
1553 280 291 1.000
1554 281 282 1.000
1555 281 283 1.000
1556 281 284 1.000
1557 281 285 1.000
1558 281 286 1.000
1559 281 288 1.000
1560 281 289 1.000
1561 281 290 1.000
1562 282 283 1.000
1563 282 286 1.000
1564 282 288 1.000
1565 282 289 1.000
1566 282 290 1.000
1567 283 284 1.000
1568 283 285 1.000
1569 283 286 1.000
1570 284 285 1.000
1571 284 286 1.000
1572 285 286 1.000
1573 285 287 1.000
1574 286 287 1.000
1575 286 288 1.000
1576 286 289 1.000
1577 287 288 1.000
1578 288 289 1.000
1579 288 290 1.000
1580 289 290 1.000
1581 289 291 1.000
1582 290 291 1.000
1583 290 292 1.000
1584 291 292 1.000
1585 291 293 1.000
1586 291 294 1.000
1587 292 293 1.000
1588 292 294 1.000
1589 292 307 1.000
1590 293 294 1.000
1591 293 307 1.000
1592 294 295 1.000
1593 294 296 1.000
1594 295 296 1.000
1595 295 297 1.000
1596 295 298 1.000
1597 296 297 1.000
1598 296 298 1.000
1599 296 299 1.000
1600 296 300 1.000
1601 296 301 1.000
1602 296 302 1.000
1603 296 303 1.000
1604 297 298 1.000
1605 297 299 1.000
1606 297 300 1.000
1607 298 299 1.000
1608 298 300 1.000
1609 299 300 1.000
1610 299 301 1.000
1611 299 302 1.000
1612 299 303 1.000
1613 300 301 1.000
1614 300 302 1.000
1615 301 302 1.000
1616 301 303 1.000
1617 302 303 1.000
1618 302 304 1.000
1619 303 304 1.000
1620 303 305 1.000
1621 304 305 1.000
1622 304 308 1.000
1623 304 309 1.000
1624 305 306 1.000
1625 305 307 1.000
1626 305 308 1.000
1627 305 309 1.000
1628 306 307 1.000
1629 306 308 1.000
1630 306 309 1.000
1631 306 310 1.000
1632 307 308 1.000
1633 307 309 1.000
1634 307 310 1.000
1635 307 311 1.000
1636 308 309 1.000
1637 308 310 1.000
1638 308 311 1.000
1639 308 312 1.000
1640 309 310 1.000
1641 309 311 1.000
1642 309 312 1.000
1643 309 314 1.000
1644 310 311 1.000
1645 310 312 1.000
1646 311 312 1.000
1647 311 329 1.000
1648 312 313 1.000
1649 312 314 1.000
1650 312 326 1.000
1651 312 327 1.000
1652 312 328 1.000
1653 312 329 1.000
1654 313 314 1.000
1655 313 315 1.000
1656 313 326 1.000
1657 313 327 1.000
1658 313 328 1.000
1659 313 329 1.000
1660 314 315 1.000
1661 314 316 1.000
1662 314 324 1.000
1663 314 325 1.000
1664 314 326 1.000
1665 315 316 1.000
1666 315 317 1.000
1667 315 324 1.000
1668 315 325 1.000
1669 315 326 1.000
1670 315 327 1.000
1671 316 317 1.000
1672 316 318 1.000
1673 316 322 1.000
1674 316 324 1.000
1675 316 325 1.000
1676 317 318 1.000
1677 317 319 1.000
1678 317 322 1.000
1679 317 323 1.000
1680 317 324 1.000
1681 317 325 1.000
1682 318 319 1.000
1683 318 320 1.000
1684 318 322 1.000
1685 318 323 1.000
1686 319 320 1.000
1687 319 321 1.000
1688 319 322 1.000
1689 319 323 1.000
1690 320 321 1.000
1691 320 322 1.000
1692 321 322 1.000
1693 321 323 1.000
1694 322 323 1.000
1695 322 324 1.000
1696 323 324 1.000
1697 323 325 1.000
1698 324 325 1.000
1699 324 326 1.000
1700 325 326 1.000
1701 325 327 1.000
1702 326 327 1.000
1703 326 328 1.000
1704 327 328 1.000
1705 327 329 1.000
1706 328 329 1.000