ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/1oewA_SC_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 10167 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: STGSATTTPIDSLDDAYITPVQIGTPAQTLNLDFDTGSSDLWVFSSETTASEVXQTIYTPSKSTTAKLLSGATWSISYGDGSSSSGDVYTDTVSVGGLTVTGQAVESAKKVSSSFTEDSTIDGLLGLAFSTLNTVSPTQQKTFFDNAKASLDSPVFTADLGYHAPGTYNFGFIDTTAYTGSITYTAVSTKQGFWEWTSTGYAVGSGTFKSTSIDGIADTGTTLLYLPATVVSAYWAQVSGAKSSSSVGGYVFPCSATLPSFTFGVGSARIVIPGDYIDFGPISTGSSSCFGGIQSSAGIGINIFGDVALKAAFVVFNGATTPTLGFASK
3 #PDB: 1oew
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: SC
8 #CUTOFF: 5.0
9 1 98 1.000
10 1 150 1.000
11 1 151 1.000
12 2 152 1.000
13 2 172 1.000
14 4 167 1.000
15 4 169 1.000
16 4 172 1.000
17 5 19 1.000
18 5 20 1.000
19 5 95 1.000
20 6 8 1.000
21 6 165 1.000
22 7 17 1.000
23 7 19 1.000
24 7 160 1.000
25 7 168 1.000
26 8 9 1.000
27 8 18 1.000
28 8 165 1.000
29 9 14 1.000
30 9 17 1.000
31 10 11 1.000
32 10 15 1.000
33 10 16 1.000
34 10 18 1.000
35 10 118 1.000
36 10 120 1.000
37 10 121 1.000
38 11 13 1.000
39 11 15 1.000
40 12 13 1.000
41 13 15 1.000
42 13 279 1.000
43 13 281 1.000
44 14 17 1.000
45 14 162 1.000
46 14 163 1.000
47 14 310 1.000
48 15 16 1.000
49 15 222 1.000
50 15 279 1.000
51 16 33 1.000
52 16 121 1.000
53 17 160 1.000
54 17 306 1.000
55 17 310 1.000
56 18 31 1.000
57 18 120 1.000
58 18 121 1.000
59 19 20 1.000
60 19 34 1.000
61 19 95 1.000
62 19 168 1.000
63 20 22 1.000
64 20 29 1.000
65 20 31 1.000
66 21 23 1.000
67 21 32 1.000
68 21 34 1.000
69 21 93 1.000
70 21 95 1.000
71 21 125 1.000
72 22 27 1.000
73 22 29 1.000
74 22 94 1.000
75 23 28 1.000
76 23 30 1.000
77 23 32 1.000
78 23 41 1.000
79 23 43 1.000
80 23 58 1.000
81 23 91 1.000
82 23 93 1.000
83 23 105 1.000
84 25 26 1.000
85 25 63 1.000
86 25 64 1.000
87 25 65 1.000
88 25 91 1.000
89 25 92 1.000
90 28 30 1.000
91 28 58 1.000
92 28 59 1.000
93 28 62 1.000
94 28 63 1.000
95 30 32 1.000
96 30 43 1.000
97 30 56 1.000
98 30 58 1.000
99 30 122 1.000
100 31 122 1.000
101 32 34 1.000
102 32 41 1.000
103 32 43 1.000
104 32 122 1.000
105 32 125 1.000
106 33 35 1.000
107 33 121 1.000
108 33 124 1.000
109 34 95 1.000
110 34 125 1.000
111 34 127 1.000
112 34 168 1.000
113 34 170 1.000
114 34 219 1.000
115 35 38 1.000
116 35 78 1.000
117 35 124 1.000
118 35 218 1.000
119 35 219 1.000
120 36 127 1.000
121 36 156 1.000
122 36 194 1.000
123 36 217 1.000
124 36 218 1.000
125 36 219 1.000
126 36 316 1.000
127 38 76 1.000
128 38 78 1.000
129 38 124 1.000
130 39 40 1.000
131 39 128 1.000
132 39 132 1.000
133 39 133 1.000
134 39 142 1.000
135 40 42 1.000
136 40 74 1.000
137 40 76 1.000
138 40 78 1.000
139 40 106 1.000
140 40 133 1.000
141 40 134 1.000
142 40 135 1.000
143 41 43 1.000
144 41 93 1.000
145 41 103 1.000
146 41 105 1.000
147 41 125 1.000
148 41 143 1.000
149 42 44 1.000
150 42 74 1.000
151 42 76 1.000
152 42 78 1.000
153 42 84 1.000
154 42 106 1.000
155 42 108 1.000
156 42 111 1.000
157 42 115 1.000
158 42 124 1.000
159 43 45 1.000
160 43 58 1.000
161 43 105 1.000
162 44 48 1.000
163 44 53 1.000
164 44 55 1.000
165 44 57 1.000
166 44 111 1.000
167 44 115 1.000
168 45 46 1.000
169 45 47 1.000
170 45 48 1.000
171 45 58 1.000
172 45 60 1.000
173 45 107 1.000
174 46 47 1.000
175 46 57 1.000
176 46 59 1.000
177 46 60 1.000
178 47 60 1.000
179 47 87 1.000
180 47 89 1.000
181 47 107 1.000
182 47 109 1.000
183 48 49 1.000
184 48 52 1.000
185 48 53 1.000
186 48 108 1.000
187 48 111 1.000
188 49 51 1.000
189 49 52 1.000
190 49 110 1.000
191 51 52 1.000
192 52 110 1.000
193 52 111 1.000
194 52 116 1.000
195 53 55 1.000
196 53 57 1.000
197 55 119 1.000
198 55 122 1.000
199 56 122 1.000
200 57 59 1.000
201 58 60 1.000
202 58 63 1.000
203 58 66 1.000
204 58 89 1.000
205 58 91 1.000
206 58 105 1.000
207 59 60 1.000
208 59 61 1.000
209 59 62 1.000
210 60 66 1.000
211 60 89 1.000
212 60 107 1.000
213 61 62 1.000
214 63 65 1.000
215 63 66 1.000
216 63 91 1.000
217 64 65 1.000
218 65 91 1.000
219 65 92 1.000
220 66 89 1.000
221 66 91 1.000
222 67 90 1.000
223 68 87 1.000
224 68 89 1.000
225 69 72 1.000
226 69 88 1.000
227 69 90 1.000
228 69 135 1.000
229 69 140 1.000
230 72 88 1.000
231 72 135 1.000
232 72 137 1.000
233 73 136 1.000
234 74 76 1.000
235 74 84 1.000
236 74 88 1.000
237 74 106 1.000
238 74 108 1.000
239 74 134 1.000
240 74 135 1.000
241 75 85 1.000
242 76 78 1.000
243 76 84 1.000
244 76 134 1.000
245 77 83 1.000
246 78 80 1.000
247 78 82 1.000
248 78 84 1.000
249 78 115 1.000
250 78 124 1.000
251 80 82 1.000
252 80 114 1.000
253 82 112 1.000
254 82 114 1.000
255 82 115 1.000
256 83 112 1.000
257 84 108 1.000
258 84 111 1.000
259 84 115 1.000
260 85 110 1.000
261 87 89 1.000
262 87 107 1.000
263 87 109 1.000
264 88 104 1.000
265 88 106 1.000
266 88 135 1.000
267 88 140 1.000
268 89 105 1.000
269 89 107 1.000
270 90 104 1.000
271 90 140 1.000
272 91 92 1.000
273 91 105 1.000
274 92 94 1.000
275 92 99 1.000
276 92 101 1.000
277 93 95 1.000
278 93 103 1.000
279 93 105 1.000
280 93 125 1.000
281 93 143 1.000
282 94 99 1.000
283 95 125 1.000
284 95 143 1.000
285 95 170 1.000
286 98 143 1.000
287 98 147 1.000
288 98 150 1.000
289 98 151 1.000
290 98 170 1.000
291 99 101 1.000
292 100 103 1.000
293 100 143 1.000
294 100 146 1.000
295 100 147 1.000
296 103 104 1.000
297 103 105 1.000
298 103 143 1.000
299 103 146 1.000
300 104 140 1.000
301 106 133 1.000
302 106 134 1.000
303 106 135 1.000
304 108 111 1.000
305 109 110 1.000
306 111 115 1.000
307 111 116 1.000
308 112 114 1.000
309 112 115 1.000
310 113 117 1.000
311 114 115 1.000
312 114 117 1.000
313 115 124 1.000
314 116 117 1.000
315 118 119 1.000
316 118 120 1.000
317 118 121 1.000
318 119 120 1.000
319 120 121 1.000
320 121 124 1.000
321 125 127 1.000
322 125 143 1.000
323 127 143 1.000
324 127 144 1.000
325 127 156 1.000
326 127 168 1.000
327 127 170 1.000
328 128 132 1.000
329 128 193 1.000
330 128 194 1.000
331 129 131 1.000
332 129 187 1.000
333 129 189 1.000
334 129 194 1.000
335 129 322 1.000
336 130 141 1.000
337 130 142 1.000
338 130 145 1.000
339 131 132 1.000
340 131 139 1.000
341 132 193 1.000
342 133 135 1.000
343 133 139 1.000
344 133 140 1.000
345 135 140 1.000
346 136 137 1.000
347 137 138 1.000
348 138 140 1.000
349 141 145 1.000
350 141 146 1.000
351 142 144 1.000
352 142 145 1.000
353 143 147 1.000
354 143 170 1.000
355 144 145 1.000
356 144 148 1.000
357 144 151 1.000
358 144 156 1.000
359 144 170 1.000
360 144 194 1.000
361 145 148 1.000
362 147 150 1.000
363 147 151 1.000
364 148 151 1.000
365 148 154 1.000
366 150 151 1.000
367 151 170 1.000
368 153 154 1.000
369 153 155 1.000
370 154 155 1.000
371 154 317 1.000
372 154 319 1.000
373 155 157 1.000
374 155 173 1.000
375 155 315 1.000
376 155 317 1.000
377 156 168 1.000
378 156 170 1.000
379 156 194 1.000
380 156 316 1.000
381 157 169 1.000
382 157 173 1.000
383 157 313 1.000
384 157 315 1.000
385 158 160 1.000
386 158 168 1.000
387 158 219 1.000
388 158 314 1.000
389 158 316 1.000
390 159 167 1.000
391 159 177 1.000
392 159 313 1.000
393 159 329 1.000
394 160 168 1.000
395 160 219 1.000
396 160 306 1.000
397 160 309 1.000
398 160 310 1.000
399 162 163 1.000
400 162 275 1.000
401 162 276 1.000
402 162 310 1.000
403 164 165 1.000
404 167 169 1.000
405 168 170 1.000
406 168 219 1.000
407 169 172 1.000
408 169 174 1.000
409 172 174 1.000
410 173 175 1.000
411 173 178 1.000
412 173 182 1.000
413 173 184 1.000
414 173 313 1.000
415 173 315 1.000
416 174 175 1.000
417 174 176 1.000
418 174 177 1.000
419 175 176 1.000
420 175 178 1.000
421 176 177 1.000
422 177 178 1.000
423 177 313 1.000
424 178 182 1.000
425 178 313 1.000
426 178 327 1.000
427 178 329 1.000
428 179 328 1.000
429 181 183 1.000
430 182 184 1.000
431 182 313 1.000
432 182 315 1.000
433 182 327 1.000
434 183 265 1.000
435 183 268 1.000
436 184 315 1.000
437 184 317 1.000
438 184 323 1.000
439 185 196 1.000
440 185 265 1.000
441 185 324 1.000
442 185 326 1.000
443 187 189 1.000
444 187 194 1.000
445 187 196 1.000
446 187 322 1.000
447 187 323 1.000
448 187 324 1.000
449 188 190 1.000
450 188 195 1.000
451 189 322 1.000
452 190 191 1.000
453 191 193 1.000
454 191 195 1.000
455 193 195 1.000
456 193 216 1.000
457 193 301 1.000
458 194 217 1.000
459 194 316 1.000
460 194 322 1.000
461 194 324 1.000
462 195 214 1.000
463 195 216 1.000
464 196 198 1.000
465 196 217 1.000
466 196 263 1.000
467 196 265 1.000
468 196 304 1.000
469 196 324 1.000
470 196 326 1.000
471 197 212 1.000
472 197 214 1.000
473 198 199 1.000
474 198 213 1.000
475 198 263 1.000
476 198 304 1.000
477 199 208 1.000
478 199 269 1.000
479 201 203 1.000
480 201 209 1.000
481 201 211 1.000
482 201 213 1.000
483 201 230 1.000
484 201 233 1.000
485 201 261 1.000
486 202 208 1.000
487 202 262 1.000
488 203 233 1.000
489 203 234 1.000
490 203 237 1.000
491 203 259 1.000
492 203 261 1.000
493 207 209 1.000
494 208 210 1.000
495 208 262 1.000
496 208 269 1.000
497 209 211 1.000
498 211 213 1.000
499 213 226 1.000
500 213 227 1.000
501 213 230 1.000
502 213 302 1.000
503 213 304 1.000
504 216 218 1.000
505 216 301 1.000
506 216 303 1.000
507 217 309 1.000
508 217 316 1.000
509 217 324 1.000
510 217 326 1.000
511 218 219 1.000
512 218 221 1.000
513 218 303 1.000
514 219 306 1.000
515 219 309 1.000
516 219 316 1.000
517 221 225 1.000
518 221 303 1.000
519 222 223 1.000
520 222 279 1.000
521 222 306 1.000
522 223 225 1.000
523 223 279 1.000
524 223 290 1.000
525 223 294 1.000
526 223 307 1.000
527 224 226 1.000
528 224 261 1.000
529 224 272 1.000
530 224 293 1.000
531 224 304 1.000
532 224 307 1.000
533 224 308 1.000
534 225 294 1.000
535 225 296 1.000
536 225 299 1.000
537 225 303 1.000
538 226 227 1.000
539 226 230 1.000
540 226 231 1.000
541 226 261 1.000
542 226 293 1.000
543 226 302 1.000
544 226 304 1.000
545 227 229 1.000
546 227 230 1.000
547 227 296 1.000
548 227 302 1.000
549 228 295 1.000
550 229 230 1.000
551 230 231 1.000
552 230 261 1.000
553 231 235 1.000
554 231 250 1.000
555 231 293 1.000
556 231 295 1.000
557 232 250 1.000
558 234 235 1.000
559 234 238 1.000
560 234 258 1.000
561 234 259 1.000
562 234 261 1.000
563 234 277 1.000
564 234 293 1.000
565 235 238 1.000
566 235 241 1.000
567 235 250 1.000
568 235 252 1.000
569 235 258 1.000
570 235 277 1.000
571 235 293 1.000
572 236 237 1.000
573 237 238 1.000
574 237 259 1.000
575 238 241 1.000
576 238 252 1.000
577 238 256 1.000
578 238 258 1.000
579 238 259 1.000
580 241 252 1.000
581 242 244 1.000
582 242 251 1.000
583 243 250 1.000
584 244 246 1.000
585 244 247 1.000
586 244 251 1.000
587 246 247 1.000
588 247 251 1.000
589 247 282 1.000
590 247 290 1.000
591 250 294 1.000
592 251 282 1.000
593 251 290 1.000
594 252 253 1.000
595 252 256 1.000
596 252 258 1.000
597 252 278 1.000
598 252 289 1.000
599 253 255 1.000
600 253 256 1.000
601 254 281 1.000
602 254 289 1.000
603 256 258 1.000
604 258 259 1.000
605 258 277 1.000
606 258 278 1.000
607 260 262 1.000
608 260 271 1.000
609 261 263 1.000
610 261 272 1.000
611 261 277 1.000
612 261 293 1.000
613 262 269 1.000
614 262 271 1.000
615 263 265 1.000
616 263 270 1.000
617 263 272 1.000
618 263 304 1.000
619 263 308 1.000
620 263 326 1.000
621 265 268 1.000
622 265 270 1.000
623 265 326 1.000
624 267 268 1.000
625 270 311 1.000
626 270 312 1.000
627 270 326 1.000
628 270 328 1.000
629 272 273 1.000
630 272 276 1.000
631 272 277 1.000
632 272 307 1.000
633 272 308 1.000
634 272 311 1.000
635 273 276 1.000
636 273 311 1.000
637 275 276 1.000
638 276 277 1.000
639 276 307 1.000
640 276 310 1.000
641 276 311 1.000
642 277 293 1.000
643 277 307 1.000
644 278 289 1.000
645 279 290 1.000
646 281 286 1.000
647 281 289 1.000
648 282 283 1.000
649 282 286 1.000
650 282 288 1.000
651 282 290 1.000
652 283 286 1.000
653 286 287 1.000
654 286 288 1.000
655 287 288 1.000
656 290 294 1.000
657 293 307 1.000
658 295 296 1.000
659 295 297 1.000
660 296 299 1.000
661 296 302 1.000
662 299 301 1.000
663 299 303 1.000
664 301 303 1.000
665 304 308 1.000
666 304 309 1.000
667 306 309 1.000
668 306 310 1.000
669 307 310 1.000
670 308 309 1.000
671 309 314 1.000
672 309 316 1.000
673 309 326 1.000
674 312 314 1.000
675 312 326 1.000
676 313 315 1.000
677 313 327 1.000
678 313 329 1.000
679 314 316 1.000
680 314 324 1.000
681 314 326 1.000
682 315 317 1.000
683 316 324 1.000
684 317 319 1.000
685 317 323 1.000
686 321 322 1.000
687 324 326 1.000