ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/2gpiA_ALL_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 5658 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: GXNQSIIFTEQLTWDVQLSAIHFTAQQQGXVIDCYIGQKVLEHLAAEKINNSEQALSLFEQFRFDIEEQAEKLIEQEAFDVQGHIQVERVD
3 #PDB: 2gpi
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: ALL
8 #CUTOFF: 5.0
9 1 3 1.000
10 3 4 1.000
11 3 5 1.000
12 3 6 1.000
13 4 5 1.000
14 4 6 1.000
15 4 27 1.000
16 4 71 1.000
17 4 75 1.000
18 5 6 1.000
19 5 7 1.000
20 5 26 1.000
21 5 27 1.000
22 5 28 1.000
23 6 7 1.000
24 6 8 1.000
25 6 25 1.000
26 6 26 1.000
27 6 27 1.000
28 6 71 1.000
29 6 74 1.000
30 6 75 1.000
31 7 8 1.000
32 7 9 1.000
33 7 24 1.000
34 7 25 1.000
35 7 26 1.000
36 8 9 1.000
37 8 10 1.000
38 8 23 1.000
39 8 24 1.000
40 8 25 1.000
41 8 26 1.000
42 8 34 1.000
43 8 63 1.000
44 8 67 1.000
45 8 70 1.000
46 8 71 1.000
47 8 74 1.000
48 9 10 1.000
49 9 11 1.000
50 9 24 1.000
51 9 25 1.000
52 9 26 1.000
53 10 11 1.000
54 10 12 1.000
55 10 24 1.000
56 10 59 1.000
57 10 60 1.000
58 10 63 1.000
59 10 67 1.000
60 11 12 1.000
61 11 13 1.000
62 11 22 1.000
63 11 23 1.000
64 11 24 1.000
65 12 13 1.000
66 12 14 1.000
67 12 22 1.000
68 12 23 1.000
69 12 56 1.000
70 12 59 1.000
71 12 60 1.000
72 12 67 1.000
73 13 14 1.000
74 13 15 1.000
75 13 20 1.000
76 13 21 1.000
77 13 22 1.000
78 14 15 1.000
79 14 16 1.000
80 14 19 1.000
81 14 20 1.000
82 14 21 1.000
83 14 22 1.000
84 14 38 1.000
85 14 49 1.000
86 14 52 1.000
87 14 55 1.000
88 15 16 1.000
89 15 17 1.000
90 15 18 1.000
91 15 19 1.000
92 15 20 1.000
93 15 22 1.000
94 15 35 1.000
95 16 17 1.000
96 16 18 1.000
97 16 19 1.000
98 17 18 1.000
99 17 19 1.000
100 18 19 1.000
101 18 20 1.000
102 18 35 1.000
103 18 86 1.000
104 19 20 1.000
105 19 21 1.000
106 19 36 1.000
107 19 37 1.000
108 19 38 1.000
109 20 21 1.000
110 20 22 1.000
111 20 35 1.000
112 20 36 1.000
113 20 37 1.000
114 20 38 1.000
115 21 22 1.000
116 21 23 1.000
117 21 34 1.000
118 21 35 1.000
119 21 36 1.000
120 21 37 1.000
121 21 41 1.000
122 21 55 1.000
123 21 56 1.000
124 21 59 1.000
125 22 23 1.000
126 22 24 1.000
127 22 33 1.000
128 22 34 1.000
129 22 35 1.000
130 23 24 1.000
131 23 25 1.000
132 23 32 1.000
133 23 33 1.000
134 23 34 1.000
135 23 35 1.000
136 23 36 1.000
137 23 59 1.000
138 23 66 1.000
139 23 67 1.000
140 23 70 1.000
141 23 87 1.000
142 24 25 1.000
143 24 26 1.000
144 24 31 1.000
145 24 32 1.000
146 24 33 1.000
147 24 34 1.000
148 25 26 1.000
149 25 27 1.000
150 25 31 1.000
151 25 32 1.000
152 25 34 1.000
153 25 74 1.000
154 26 27 1.000
155 26 28 1.000
156 26 29 1.000
157 26 31 1.000
158 26 32 1.000
159 27 28 1.000
160 27 29 1.000
161 27 31 1.000
162 27 32 1.000
163 28 29 1.000
164 29 31 1.000
165 31 32 1.000
166 31 33 1.000
167 32 33 1.000
168 32 34 1.000
169 32 74 1.000
170 32 79 1.000
171 32 83 1.000
172 32 85 1.000
173 33 34 1.000
174 33 35 1.000
175 33 83 1.000
176 33 84 1.000
177 33 85 1.000
178 34 35 1.000
179 34 36 1.000
180 34 70 1.000
181 34 74 1.000
182 34 85 1.000
183 35 36 1.000
184 35 37 1.000
185 35 84 1.000
186 35 85 1.000
187 35 86 1.000
188 35 87 1.000
189 36 37 1.000
190 36 38 1.000
191 36 40 1.000
192 36 41 1.000
193 36 44 1.000
194 36 59 1.000
195 36 66 1.000
196 36 87 1.000
197 36 90 1.000
198 37 38 1.000
199 37 39 1.000
200 37 40 1.000
201 37 41 1.000
202 37 42 1.000
203 37 87 1.000
204 38 39 1.000
205 38 40 1.000
206 38 41 1.000
207 38 42 1.000
208 38 43 1.000
209 38 49 1.000
210 39 40 1.000
211 39 41 1.000
212 39 42 1.000
213 39 43 1.000
214 39 44 1.000
215 40 41 1.000
216 40 42 1.000
217 40 43 1.000
218 40 44 1.000
219 40 45 1.000
220 40 87 1.000
221 40 88 1.000
222 40 89 1.000
223 40 90 1.000
224 41 42 1.000
225 41 43 1.000
226 41 44 1.000
227 41 45 1.000
228 41 46 1.000
229 41 47 1.000
230 41 49 1.000
231 41 55 1.000
232 41 58 1.000
233 41 59 1.000
234 41 66 1.000
235 42 43 1.000
236 42 44 1.000
237 42 45 1.000
238 42 46 1.000
239 42 47 1.000
240 42 48 1.000
241 42 49 1.000
242 43 44 1.000
243 43 45 1.000
244 43 46 1.000
245 44 45 1.000
246 44 46 1.000
247 44 62 1.000
248 44 66 1.000
249 44 90 1.000
250 44 91 1.000
251 45 46 1.000
252 45 47 1.000
253 45 58 1.000
254 45 62 1.000
255 46 47 1.000
256 46 48 1.000
257 47 48 1.000
258 47 49 1.000
259 47 54 1.000
260 47 58 1.000
261 48 49 1.000
262 48 50 1.000
263 48 54 1.000
264 49 50 1.000
265 49 51 1.000
266 49 54 1.000
267 49 55 1.000
268 49 58 1.000
269 50 51 1.000
270 50 52 1.000
271 50 54 1.000
272 51 52 1.000
273 51 53 1.000
274 51 54 1.000
275 51 55 1.000
276 52 53 1.000
277 52 54 1.000
278 52 55 1.000
279 52 56 1.000
280 53 54 1.000
281 53 55 1.000
282 53 56 1.000
283 53 57 1.000
284 54 55 1.000
285 54 56 1.000
286 54 57 1.000
287 54 58 1.000
288 54 59 1.000
289 55 56 1.000
290 55 57 1.000
291 55 58 1.000
292 55 59 1.000
293 56 57 1.000
294 56 58 1.000
295 56 59 1.000
296 56 60 1.000
297 57 58 1.000
298 57 59 1.000
299 57 60 1.000
300 57 61 1.000
301 58 59 1.000
302 58 60 1.000
303 58 61 1.000
304 58 62 1.000
305 58 63 1.000
306 58 66 1.000
307 59 60 1.000
308 59 61 1.000
309 59 62 1.000
310 59 63 1.000
311 59 66 1.000
312 59 67 1.000
313 60 61 1.000
314 60 62 1.000
315 60 63 1.000
316 61 62 1.000
317 61 63 1.000
318 62 63 1.000
319 62 64 1.000
320 62 65 1.000
321 62 66 1.000
322 62 67 1.000
323 62 91 1.000
324 63 64 1.000
325 63 65 1.000
326 63 66 1.000
327 63 67 1.000
328 63 68 1.000
329 64 65 1.000
330 64 66 1.000
331 64 67 1.000
332 64 68 1.000
333 64 69 1.000
334 65 66 1.000
335 65 67 1.000
336 65 68 1.000
337 65 69 1.000
338 65 90 1.000
339 65 91 1.000
340 66 67 1.000
341 66 68 1.000
342 66 69 1.000
343 66 70 1.000
344 66 87 1.000
345 66 90 1.000
346 67 68 1.000
347 67 69 1.000
348 67 70 1.000
349 67 71 1.000
350 67 72 1.000
351 68 69 1.000
352 68 70 1.000
353 68 71 1.000
354 68 72 1.000
355 69 70 1.000
356 69 71 1.000
357 69 72 1.000
358 69 73 1.000
359 69 87 1.000
360 69 89 1.000
361 69 90 1.000
362 70 71 1.000
363 70 72 1.000
364 70 73 1.000
365 70 74 1.000
366 70 85 1.000
367 70 87 1.000
368 71 72 1.000
369 71 73 1.000
370 71 74 1.000
371 71 75 1.000
372 72 73 1.000
373 72 74 1.000
374 72 75 1.000
375 72 76 1.000
376 73 74 1.000
377 73 75 1.000
378 73 76 1.000
379 73 77 1.000
380 73 78 1.000
381 73 79 1.000
382 73 85 1.000
383 73 86 1.000
384 73 87 1.000
385 74 75 1.000
386 74 76 1.000
387 74 77 1.000
388 74 78 1.000
389 74 79 1.000
390 74 85 1.000
391 75 76 1.000
392 75 77 1.000
393 76 77 1.000
394 76 78 1.000
395 77 78 1.000
396 77 79 1.000
397 78 79 1.000
398 78 80 1.000
399 78 84 1.000
400 78 85 1.000
401 78 86 1.000
402 79 80 1.000
403 79 81 1.000
404 79 83 1.000
405 79 84 1.000
406 79 85 1.000
407 80 81 1.000
408 80 82 1.000
409 80 83 1.000
410 80 84 1.000
411 80 85 1.000
412 80 86 1.000
413 81 82 1.000
414 81 83 1.000
415 82 83 1.000
416 82 84 1.000
417 83 84 1.000
418 83 85 1.000
419 84 85 1.000
420 84 86 1.000
421 85 86 1.000
422 85 87 1.000
423 86 87 1.000
424 86 88 1.000
425 87 88 1.000
426 87 89 1.000
427 87 90 1.000
428 88 89 1.000
429 88 90 1.000
430 89 90 1.000
431 89 91 1.000
432 90 91 1.000