ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/2gpiA_BB_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 4231 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: GXNQSIIFTEQLTWDVQLSAIHFTAQQQGXVIDCYIGQKVLEHLAAEKINNSEQALSLFEQFRFDIEEQAEKLIEQEAFDVQGHIQVERVD
3 #PDB: 2gpi
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: BB
8 #CUTOFF: 5.0
9 1 3 1.000
10 3 4 1.000
11 3 5 1.000
12 4 5 1.000
13 4 6 1.000
14 5 6 1.000
15 5 7 1.000
16 5 26 1.000
17 5 27 1.000
18 5 28 1.000
19 6 7 1.000
20 6 8 1.000
21 6 26 1.000
22 6 27 1.000
23 7 8 1.000
24 7 9 1.000
25 7 24 1.000
26 7 25 1.000
27 7 26 1.000
28 8 9 1.000
29 8 10 1.000
30 8 24 1.000
31 8 25 1.000
32 8 26 1.000
33 9 10 1.000
34 9 11 1.000
35 9 24 1.000
36 9 25 1.000
37 10 11 1.000
38 10 12 1.000
39 10 24 1.000
40 11 12 1.000
41 11 13 1.000
42 11 22 1.000
43 11 23 1.000
44 11 24 1.000
45 12 13 1.000
46 12 14 1.000
47 12 22 1.000
48 12 23 1.000
49 13 14 1.000
50 13 15 1.000
51 13 20 1.000
52 13 21 1.000
53 13 22 1.000
54 14 15 1.000
55 14 16 1.000
56 14 20 1.000
57 14 21 1.000
58 14 22 1.000
59 15 16 1.000
60 15 17 1.000
61 15 18 1.000
62 15 19 1.000
63 15 20 1.000
64 15 22 1.000
65 16 17 1.000
66 16 18 1.000
67 16 19 1.000
68 17 18 1.000
69 17 19 1.000
70 18 19 1.000
71 18 20 1.000
72 19 20 1.000
73 19 21 1.000
74 19 36 1.000
75 19 37 1.000
76 19 38 1.000
77 20 21 1.000
78 20 22 1.000
79 20 36 1.000
80 20 37 1.000
81 20 38 1.000
82 21 22 1.000
83 21 23 1.000
84 21 34 1.000
85 21 35 1.000
86 21 36 1.000
87 21 37 1.000
88 22 23 1.000
89 22 24 1.000
90 22 34 1.000
91 22 35 1.000
92 23 24 1.000
93 23 25 1.000
94 23 32 1.000
95 23 33 1.000
96 23 34 1.000
97 23 35 1.000
98 24 25 1.000
99 24 26 1.000
100 24 32 1.000
101 24 34 1.000
102 25 26 1.000
103 25 27 1.000
104 25 31 1.000
105 25 32 1.000
106 26 27 1.000
107 26 28 1.000
108 26 31 1.000
109 26 32 1.000
110 27 28 1.000
111 27 29 1.000
112 27 31 1.000
113 28 29 1.000
114 29 31 1.000
115 31 32 1.000
116 31 33 1.000
117 32 33 1.000
118 32 34 1.000
119 33 34 1.000
120 33 35 1.000
121 33 83 1.000
122 33 84 1.000
123 33 85 1.000
124 34 35 1.000
125 34 36 1.000
126 34 85 1.000
127 35 36 1.000
128 35 37 1.000
129 35 85 1.000
130 35 86 1.000
131 35 87 1.000
132 36 37 1.000
133 36 38 1.000
134 36 87 1.000
135 37 38 1.000
136 37 39 1.000
137 37 40 1.000
138 37 41 1.000
139 37 42 1.000
140 37 87 1.000
141 38 39 1.000
142 38 40 1.000
143 38 41 1.000
144 38 42 1.000
145 38 43 1.000
146 39 40 1.000
147 39 41 1.000
148 39 42 1.000
149 39 43 1.000
150 39 44 1.000
151 40 41 1.000
152 40 42 1.000
153 40 43 1.000
154 40 44 1.000
155 40 45 1.000
156 41 42 1.000
157 41 43 1.000
158 41 44 1.000
159 41 45 1.000
160 41 46 1.000
161 41 47 1.000
162 42 43 1.000
163 42 44 1.000
164 42 45 1.000
165 42 46 1.000
166 42 47 1.000
167 43 44 1.000
168 43 45 1.000
169 43 46 1.000
170 44 45 1.000
171 44 46 1.000
172 45 46 1.000
173 45 47 1.000
174 46 47 1.000
175 46 48 1.000
176 47 48 1.000
177 47 49 1.000
178 48 49 1.000
179 48 50 1.000
180 49 50 1.000
181 49 51 1.000
182 50 51 1.000
183 50 52 1.000
184 51 52 1.000
185 51 53 1.000
186 51 54 1.000
187 51 55 1.000
188 52 53 1.000
189 52 54 1.000
190 52 55 1.000
191 52 56 1.000
192 53 54 1.000
193 53 55 1.000
194 53 56 1.000
195 53 57 1.000
196 54 55 1.000
197 54 56 1.000
198 54 57 1.000
199 54 58 1.000
200 54 59 1.000
201 55 56 1.000
202 55 57 1.000
203 55 58 1.000
204 55 59 1.000
205 56 57 1.000
206 56 58 1.000
207 56 59 1.000
208 56 60 1.000
209 57 58 1.000
210 57 59 1.000
211 57 60 1.000
212 57 61 1.000
213 58 59 1.000
214 58 60 1.000
215 58 61 1.000
216 58 62 1.000
217 58 63 1.000
218 59 60 1.000
219 59 61 1.000
220 59 62 1.000
221 59 63 1.000
222 60 61 1.000
223 60 62 1.000
224 60 63 1.000
225 61 62 1.000
226 61 63 1.000
227 62 63 1.000
228 62 64 1.000
229 62 65 1.000
230 62 66 1.000
231 62 67 1.000
232 63 64 1.000
233 63 65 1.000
234 63 66 1.000
235 63 67 1.000
236 63 68 1.000
237 64 65 1.000
238 64 66 1.000
239 64 67 1.000
240 64 68 1.000
241 64 69 1.000
242 65 66 1.000
243 65 67 1.000
244 65 68 1.000
245 65 69 1.000
246 66 67 1.000
247 66 68 1.000
248 66 69 1.000
249 66 70 1.000
250 67 68 1.000
251 67 69 1.000
252 67 70 1.000
253 67 71 1.000
254 67 72 1.000
255 68 69 1.000
256 68 70 1.000
257 68 71 1.000
258 68 72 1.000
259 69 70 1.000
260 69 71 1.000
261 69 72 1.000
262 69 73 1.000
263 70 71 1.000
264 70 72 1.000
265 70 73 1.000
266 70 74 1.000
267 71 72 1.000
268 71 73 1.000
269 71 74 1.000
270 71 75 1.000
271 72 73 1.000
272 72 74 1.000
273 72 75 1.000
274 72 76 1.000
275 73 74 1.000
276 73 75 1.000
277 73 76 1.000
278 73 77 1.000
279 73 78 1.000
280 73 79 1.000
281 74 75 1.000
282 74 76 1.000
283 74 77 1.000
284 74 78 1.000
285 75 76 1.000
286 75 77 1.000
287 76 77 1.000
288 76 78 1.000
289 77 78 1.000
290 77 79 1.000
291 78 79 1.000
292 78 80 1.000
293 78 84 1.000
294 78 85 1.000
295 78 86 1.000
296 79 80 1.000
297 79 81 1.000
298 79 84 1.000
299 80 81 1.000
300 80 82 1.000
301 80 83 1.000
302 80 84 1.000
303 81 82 1.000
304 81 83 1.000
305 82 83 1.000
306 82 84 1.000
307 83 84 1.000
308 83 85 1.000
309 84 85 1.000
310 84 86 1.000
311 85 86 1.000
312 85 87 1.000
313 86 87 1.000
314 86 88 1.000
315 87 88 1.000
316 87 89 1.000
317 88 89 1.000
318 88 90 1.000
319 89 90 1.000
320 89 91 1.000
321 90 91 1.000