ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/2gpiA_Ca_8.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 5160 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: GXNQSIIFTEQLTWDVQLSAIHFTAQQQGXVIDCYIGQKVLEHLAAEKINNSEQALSLFEQFRFDIEEQAEKLIEQEAFDVQGHIQVERVD
3 #PDB: 2gpi
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: Ca
8 #CUTOFF: 8.0
9 1 3 1.000
10 3 4 1.000
11 3 5 1.000
12 4 5 1.000
13 4 6 1.000
14 4 27 1.000
15 5 6 1.000
16 5 7 1.000
17 5 27 1.000
18 5 28 1.000
19 6 7 1.000
20 6 8 1.000
21 6 25 1.000
22 6 26 1.000
23 6 27 1.000
24 6 28 1.000
25 6 71 1.000
26 7 8 1.000
27 7 9 1.000
28 7 25 1.000
29 7 26 1.000
30 7 27 1.000
31 8 9 1.000
32 8 10 1.000
33 8 23 1.000
34 8 24 1.000
35 8 25 1.000
36 8 26 1.000
37 8 67 1.000
38 9 10 1.000
39 9 11 1.000
40 9 23 1.000
41 9 24 1.000
42 9 25 1.000
43 9 26 1.000
44 10 11 1.000
45 10 12 1.000
46 10 23 1.000
47 10 24 1.000
48 10 25 1.000
49 11 12 1.000
50 11 13 1.000
51 11 22 1.000
52 11 23 1.000
53 11 24 1.000
54 12 13 1.000
55 12 14 1.000
56 12 21 1.000
57 12 22 1.000
58 12 23 1.000
59 12 24 1.000
60 12 56 1.000
61 13 14 1.000
62 13 15 1.000
63 13 21 1.000
64 13 22 1.000
65 13 23 1.000
66 13 56 1.000
67 14 15 1.000
68 14 16 1.000
69 14 19 1.000
70 14 20 1.000
71 14 21 1.000
72 14 22 1.000
73 14 52 1.000
74 14 56 1.000
75 15 16 1.000
76 15 17 1.000
77 15 18 1.000
78 15 19 1.000
79 15 20 1.000
80 15 21 1.000
81 15 22 1.000
82 16 17 1.000
83 16 18 1.000
84 16 19 1.000
85 16 20 1.000
86 17 18 1.000
87 17 19 1.000
88 18 19 1.000
89 18 20 1.000
90 18 37 1.000
91 19 20 1.000
92 19 21 1.000
93 19 37 1.000
94 19 38 1.000
95 20 21 1.000
96 20 22 1.000
97 20 35 1.000
98 20 36 1.000
99 20 37 1.000
100 20 38 1.000
101 21 22 1.000
102 21 23 1.000
103 21 35 1.000
104 21 36 1.000
105 21 37 1.000
106 21 38 1.000
107 21 55 1.000
108 21 56 1.000
109 21 59 1.000
110 22 23 1.000
111 22 24 1.000
112 22 33 1.000
113 22 34 1.000
114 22 35 1.000
115 22 36 1.000
116 23 24 1.000
117 23 25 1.000
118 23 33 1.000
119 23 34 1.000
120 23 35 1.000
121 24 25 1.000
122 24 26 1.000
123 24 31 1.000
124 24 32 1.000
125 24 33 1.000
126 24 34 1.000
127 25 26 1.000
128 25 27 1.000
129 25 31 1.000
130 25 32 1.000
131 25 33 1.000
132 25 34 1.000
133 26 27 1.000
134 26 28 1.000
135 26 29 1.000
136 26 31 1.000
137 26 32 1.000
138 27 28 1.000
139 27 29 1.000
140 27 31 1.000
141 27 32 1.000
142 28 29 1.000
143 29 31 1.000
144 31 32 1.000
145 31 33 1.000
146 32 33 1.000
147 32 34 1.000
148 32 83 1.000
149 32 84 1.000
150 32 85 1.000
151 33 34 1.000
152 33 35 1.000
153 33 83 1.000
154 33 84 1.000
155 33 85 1.000
156 34 35 1.000
157 34 36 1.000
158 34 70 1.000
159 34 84 1.000
160 34 85 1.000
161 34 86 1.000
162 34 87 1.000
163 35 36 1.000
164 35 37 1.000
165 35 84 1.000
166 35 85 1.000
167 35 86 1.000
168 35 87 1.000
169 36 37 1.000
170 36 38 1.000
171 36 40 1.000
172 36 41 1.000
173 36 86 1.000
174 36 87 1.000
175 36 88 1.000
176 37 38 1.000
177 37 39 1.000
178 37 40 1.000
179 37 41 1.000
180 37 86 1.000
181 37 87 1.000
182 37 88 1.000
183 38 39 1.000
184 38 40 1.000
185 38 41 1.000
186 38 42 1.000
187 38 49 1.000
188 38 55 1.000
189 39 40 1.000
190 39 41 1.000
191 39 42 1.000
192 39 43 1.000
193 40 41 1.000
194 40 42 1.000
195 40 43 1.000
196 40 44 1.000
197 40 87 1.000
198 40 88 1.000
199 40 89 1.000
200 41 42 1.000
201 41 43 1.000
202 41 44 1.000
203 41 45 1.000
204 41 58 1.000
205 41 59 1.000
206 42 43 1.000
207 42 44 1.000
208 42 45 1.000
209 42 46 1.000
210 42 47 1.000
211 42 48 1.000
212 42 49 1.000
213 43 44 1.000
214 43 45 1.000
215 43 46 1.000
216 43 47 1.000
217 44 45 1.000
218 44 46 1.000
219 44 47 1.000
220 44 90 1.000
221 44 91 1.000
222 45 46 1.000
223 45 47 1.000
224 45 58 1.000
225 46 47 1.000
226 46 48 1.000
227 47 48 1.000
228 47 49 1.000
229 48 49 1.000
230 48 50 1.000
231 49 50 1.000
232 49 51 1.000
233 49 52 1.000
234 49 54 1.000
235 49 55 1.000
236 50 51 1.000
237 50 52 1.000
238 50 54 1.000
239 50 55 1.000
240 51 52 1.000
241 51 53 1.000
242 51 54 1.000
243 51 55 1.000
244 52 53 1.000
245 52 54 1.000
246 52 55 1.000
247 52 56 1.000
248 53 54 1.000
249 53 55 1.000
250 53 56 1.000
251 53 57 1.000
252 54 55 1.000
253 54 56 1.000
254 54 57 1.000
255 54 58 1.000
256 55 56 1.000
257 55 57 1.000
258 55 58 1.000
259 55 59 1.000
260 56 57 1.000
261 56 58 1.000
262 56 59 1.000
263 56 60 1.000
264 57 58 1.000
265 57 59 1.000
266 57 60 1.000
267 57 61 1.000
268 58 59 1.000
269 58 60 1.000
270 58 61 1.000
271 58 62 1.000
272 59 60 1.000
273 59 61 1.000
274 59 62 1.000
275 59 63 1.000
276 59 66 1.000
277 60 61 1.000
278 60 62 1.000
279 60 63 1.000
280 61 62 1.000
281 61 63 1.000
282 62 63 1.000
283 62 64 1.000
284 62 65 1.000
285 62 66 1.000
286 63 64 1.000
287 63 65 1.000
288 63 66 1.000
289 63 67 1.000
290 64 65 1.000
291 64 66 1.000
292 64 67 1.000
293 64 68 1.000
294 65 66 1.000
295 65 67 1.000
296 65 68 1.000
297 65 69 1.000
298 65 90 1.000
299 65 91 1.000
300 66 67 1.000
301 66 68 1.000
302 66 69 1.000
303 66 70 1.000
304 66 87 1.000
305 66 90 1.000
306 67 68 1.000
307 67 69 1.000
308 67 70 1.000
309 67 71 1.000
310 68 69 1.000
311 68 70 1.000
312 68 71 1.000
313 68 72 1.000
314 69 70 1.000
315 69 71 1.000
316 69 72 1.000
317 69 73 1.000
318 69 87 1.000
319 69 89 1.000
320 69 90 1.000
321 70 71 1.000
322 70 72 1.000
323 70 73 1.000
324 70 74 1.000
325 70 85 1.000
326 70 86 1.000
327 70 87 1.000
328 71 72 1.000
329 71 73 1.000
330 71 74 1.000
331 71 75 1.000
332 72 73 1.000
333 72 74 1.000
334 72 75 1.000
335 72 76 1.000
336 73 74 1.000
337 73 75 1.000
338 73 76 1.000
339 73 77 1.000
340 73 78 1.000
341 73 79 1.000
342 73 85 1.000
343 73 87 1.000
344 74 75 1.000
345 74 76 1.000
346 74 77 1.000
347 74 78 1.000
348 74 79 1.000
349 74 85 1.000
350 75 76 1.000
351 75 77 1.000
352 75 78 1.000
353 76 77 1.000
354 76 78 1.000
355 77 78 1.000
356 77 79 1.000
357 78 79 1.000
358 78 80 1.000
359 78 85 1.000
360 79 80 1.000
361 79 81 1.000
362 79 82 1.000
363 79 83 1.000
364 79 84 1.000
365 79 85 1.000
366 79 86 1.000
367 80 81 1.000
368 80 82 1.000
369 80 83 1.000
370 80 84 1.000
371 80 85 1.000
372 80 86 1.000
373 81 82 1.000
374 81 83 1.000
375 81 84 1.000
376 82 83 1.000
377 82 84 1.000
378 83 84 1.000
379 83 85 1.000
380 84 85 1.000
381 84 86 1.000
382 85 86 1.000
383 85 87 1.000
384 86 87 1.000
385 86 88 1.000
386 87 88 1.000
387 87 89 1.000
388 87 90 1.000
389 88 89 1.000
390 88 90 1.000
391 89 90 1.000
392 89 91 1.000
393 90 91 1.000