ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/2gpiA_Cb_8.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 5312 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: GXNQSIIFTEQLTWDVQLSAIHFTAQQQGXVIDCYIGQKVLEHLAAEKINNSEQALSLFEQFRFDIEEQAEKLIEQEAFDVQGHIQVERVD
3 #PDB: 2gpi
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: Cb
8 #CUTOFF: 8.0
9 3 4 1.000
10 3 5 1.000
11 4 5 1.000
12 4 6 1.000
13 4 27 1.000
14 4 74 1.000
15 4 75 1.000
16 5 6 1.000
17 5 7 1.000
18 5 27 1.000
19 5 28 1.000
20 6 7 1.000
21 6 8 1.000
22 6 25 1.000
23 6 26 1.000
24 6 27 1.000
25 6 32 1.000
26 6 71 1.000
27 6 74 1.000
28 6 75 1.000
29 7 8 1.000
30 7 9 1.000
31 7 25 1.000
32 7 26 1.000
33 7 27 1.000
34 8 9 1.000
35 8 10 1.000
36 8 23 1.000
37 8 24 1.000
38 8 25 1.000
39 8 26 1.000
40 8 67 1.000
41 8 70 1.000
42 8 71 1.000
43 9 10 1.000
44 9 11 1.000
45 9 24 1.000
46 9 25 1.000
47 9 26 1.000
48 9 31 1.000
49 10 11 1.000
50 10 12 1.000
51 10 23 1.000
52 10 24 1.000
53 11 12 1.000
54 11 13 1.000
55 11 22 1.000
56 11 23 1.000
57 11 24 1.000
58 12 13 1.000
59 12 21 1.000
60 12 22 1.000
61 12 23 1.000
62 12 56 1.000
63 12 59 1.000
64 12 60 1.000
65 13 14 1.000
66 13 15 1.000
67 13 21 1.000
68 13 22 1.000
69 13 23 1.000
70 14 15 1.000
71 14 16 1.000
72 14 20 1.000
73 14 21 1.000
74 14 22 1.000
75 14 52 1.000
76 14 55 1.000
77 14 56 1.000
78 15 16 1.000
79 15 17 1.000
80 15 18 1.000
81 15 19 1.000
82 15 20 1.000
83 15 21 1.000
84 15 22 1.000
85 15 35 1.000
86 16 17 1.000
87 16 18 1.000
88 16 19 1.000
89 17 18 1.000
90 17 19 1.000
91 18 19 1.000
92 18 20 1.000
93 18 22 1.000
94 18 35 1.000
95 18 37 1.000
96 19 20 1.000
97 19 37 1.000
98 19 38 1.000
99 20 21 1.000
100 20 22 1.000
101 20 35 1.000
102 20 36 1.000
103 20 37 1.000
104 20 38 1.000
105 21 22 1.000
106 21 23 1.000
107 21 35 1.000
108 21 36 1.000
109 21 37 1.000
110 21 41 1.000
111 21 55 1.000
112 21 56 1.000
113 21 59 1.000
114 22 23 1.000
115 22 24 1.000
116 22 33 1.000
117 22 34 1.000
118 22 35 1.000
119 23 24 1.000
120 23 25 1.000
121 23 34 1.000
122 23 35 1.000
123 23 36 1.000
124 23 59 1.000
125 23 66 1.000
126 23 67 1.000
127 23 70 1.000
128 24 25 1.000
129 24 26 1.000
130 24 31 1.000
131 24 32 1.000
132 24 33 1.000
133 24 34 1.000
134 25 26 1.000
135 25 27 1.000
136 25 31 1.000
137 25 32 1.000
138 25 33 1.000
139 25 34 1.000
140 25 67 1.000
141 25 70 1.000
142 25 71 1.000
143 25 74 1.000
144 25 85 1.000
145 26 27 1.000
146 26 29 1.000
147 26 31 1.000
148 26 32 1.000
149 27 28 1.000
150 27 29 1.000
151 27 32 1.000
152 27 74 1.000
153 28 29 1.000
154 29 31 1.000
155 31 32 1.000
156 31 33 1.000
157 32 33 1.000
158 32 34 1.000
159 32 74 1.000
160 32 83 1.000
161 32 84 1.000
162 32 85 1.000
163 33 34 1.000
164 33 35 1.000
165 33 83 1.000
166 33 84 1.000
167 33 85 1.000
168 34 35 1.000
169 34 36 1.000
170 34 70 1.000
171 34 84 1.000
172 34 85 1.000
173 34 86 1.000
174 34 87 1.000
175 35 36 1.000
176 35 37 1.000
177 35 84 1.000
178 35 85 1.000
179 35 86 1.000
180 35 87 1.000
181 36 37 1.000
182 36 40 1.000
183 36 41 1.000
184 36 59 1.000
185 36 66 1.000
186 36 86 1.000
187 36 87 1.000
188 36 90 1.000
189 37 38 1.000
190 37 39 1.000
191 37 40 1.000
192 37 41 1.000
193 37 86 1.000
194 37 87 1.000
195 38 39 1.000
196 38 40 1.000
197 38 41 1.000
198 38 42 1.000
199 38 49 1.000
200 38 55 1.000
201 39 40 1.000
202 39 41 1.000
203 39 42 1.000
204 39 43 1.000
205 40 41 1.000
206 40 42 1.000
207 40 43 1.000
208 40 44 1.000
209 40 87 1.000
210 40 88 1.000
211 40 89 1.000
212 40 90 1.000
213 41 42 1.000
214 41 43 1.000
215 41 44 1.000
216 41 45 1.000
217 41 49 1.000
218 41 55 1.000
219 41 58 1.000
220 41 59 1.000
221 41 62 1.000
222 42 43 1.000
223 42 44 1.000
224 42 45 1.000
225 42 46 1.000
226 42 47 1.000
227 42 48 1.000
228 42 49 1.000
229 43 44 1.000
230 43 45 1.000
231 43 46 1.000
232 44 45 1.000
233 44 46 1.000
234 44 58 1.000
235 44 62 1.000
236 44 65 1.000
237 44 66 1.000
238 44 90 1.000
239 44 91 1.000
240 45 46 1.000
241 45 47 1.000
242 45 58 1.000
243 45 61 1.000
244 45 62 1.000
245 46 47 1.000
246 47 48 1.000
247 47 49 1.000
248 47 54 1.000
249 47 58 1.000
250 48 49 1.000
251 48 50 1.000
252 49 50 1.000
253 49 51 1.000
254 49 54 1.000
255 49 55 1.000
256 49 58 1.000
257 50 51 1.000
258 50 54 1.000
259 51 52 1.000
260 51 53 1.000
261 51 54 1.000
262 51 55 1.000
263 52 53 1.000
264 52 54 1.000
265 52 55 1.000
266 52 56 1.000
267 53 54 1.000
268 53 55 1.000
269 53 56 1.000
270 53 57 1.000
271 54 55 1.000
272 54 56 1.000
273 54 57 1.000
274 54 58 1.000
275 55 56 1.000
276 55 57 1.000
277 55 58 1.000
278 55 59 1.000
279 56 57 1.000
280 56 58 1.000
281 56 59 1.000
282 56 60 1.000
283 57 58 1.000
284 57 59 1.000
285 57 60 1.000
286 57 61 1.000
287 58 59 1.000
288 58 60 1.000
289 58 61 1.000
290 58 62 1.000
291 59 60 1.000
292 59 61 1.000
293 59 62 1.000
294 59 63 1.000
295 59 66 1.000
296 60 61 1.000
297 60 62 1.000
298 60 63 1.000
299 61 62 1.000
300 61 63 1.000
301 62 63 1.000
302 62 64 1.000
303 62 65 1.000
304 62 66 1.000
305 62 90 1.000
306 63 64 1.000
307 63 65 1.000
308 63 66 1.000
309 63 67 1.000
310 64 65 1.000
311 64 66 1.000
312 64 67 1.000
313 64 68 1.000
314 65 66 1.000
315 65 67 1.000
316 65 68 1.000
317 65 69 1.000
318 65 90 1.000
319 65 91 1.000
320 66 67 1.000
321 66 68 1.000
322 66 69 1.000
323 66 70 1.000
324 66 87 1.000
325 66 90 1.000
326 67 68 1.000
327 67 69 1.000
328 67 70 1.000
329 67 71 1.000
330 68 69 1.000
331 68 70 1.000
332 68 71 1.000
333 68 72 1.000
334 69 70 1.000
335 69 71 1.000
336 69 72 1.000
337 69 73 1.000
338 69 87 1.000
339 69 89 1.000
340 69 90 1.000
341 70 71 1.000
342 70 72 1.000
343 70 73 1.000
344 70 74 1.000
345 70 85 1.000
346 70 87 1.000
347 71 72 1.000
348 71 73 1.000
349 71 74 1.000
350 71 75 1.000
351 72 73 1.000
352 72 74 1.000
353 72 75 1.000
354 72 76 1.000
355 73 74 1.000
356 73 75 1.000
357 73 76 1.000
358 73 78 1.000
359 73 85 1.000
360 73 86 1.000
361 73 87 1.000
362 74 75 1.000
363 74 76 1.000
364 74 77 1.000
365 74 78 1.000
366 74 79 1.000
367 74 85 1.000
368 75 76 1.000
369 75 77 1.000
370 76 77 1.000
371 76 78 1.000
372 77 78 1.000
373 77 79 1.000
374 78 79 1.000
375 78 80 1.000
376 78 85 1.000
377 79 80 1.000
378 79 83 1.000
379 79 84 1.000
380 79 85 1.000
381 80 81 1.000
382 80 82 1.000
383 80 83 1.000
384 80 84 1.000
385 80 85 1.000
386 80 86 1.000
387 81 82 1.000
388 81 83 1.000
389 82 83 1.000
390 82 84 1.000
391 83 84 1.000
392 83 85 1.000
393 84 85 1.000
394 84 86 1.000
395 85 86 1.000
396 85 87 1.000
397 86 87 1.000
398 86 88 1.000
399 87 88 1.000
400 87 89 1.000
401 87 90 1.000
402 88 89 1.000
403 89 90 1.000
404 89 91 1.000
405 90 91 1.000