ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/2gpiA_SC_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 3 months ago) by duarte
File size: 2526 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: GXNQSIIFTEQLTWDVQLSAIHFTAQQQGXVIDCYIGQKVLEHLAAEKINNSEQALSLFEQFRFDIEEQAEKLIEQEAFDVQGHIQVERVD
3 #PDB: 2gpi
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: SC
8 #CUTOFF: 5.0
9 3 5 1.000
10 4 6 1.000
11 4 27 1.000
12 4 71 1.000
13 4 75 1.000
14 5 27 1.000
15 6 8 1.000
16 6 25 1.000
17 6 27 1.000
18 6 71 1.000
19 6 74 1.000
20 6 75 1.000
21 7 9 1.000
22 7 26 1.000
23 8 10 1.000
24 8 23 1.000
25 8 25 1.000
26 8 34 1.000
27 8 67 1.000
28 8 70 1.000
29 8 71 1.000
30 8 74 1.000
31 9 11 1.000
32 9 24 1.000
33 9 26 1.000
34 10 12 1.000
35 10 59 1.000
36 10 60 1.000
37 10 63 1.000
38 10 67 1.000
39 11 24 1.000
40 12 23 1.000
41 12 56 1.000
42 12 59 1.000
43 12 60 1.000
44 12 67 1.000
45 13 22 1.000
46 14 16 1.000
47 14 19 1.000
48 14 21 1.000
49 14 38 1.000
50 14 49 1.000
51 14 52 1.000
52 14 55 1.000
53 15 17 1.000
54 15 18 1.000
55 15 20 1.000
56 15 22 1.000
57 15 35 1.000
58 17 18 1.000
59 18 20 1.000
60 18 35 1.000
61 18 86 1.000
62 19 38 1.000
63 20 35 1.000
64 21 23 1.000
65 21 36 1.000
66 21 41 1.000
67 21 55 1.000
68 21 56 1.000
69 21 59 1.000
70 22 24 1.000
71 22 33 1.000
72 22 35 1.000
73 23 34 1.000
74 23 36 1.000
75 23 59 1.000
76 23 66 1.000
77 23 67 1.000
78 23 70 1.000
79 23 87 1.000
80 24 31 1.000
81 24 33 1.000
82 25 32 1.000
83 25 34 1.000
84 25 74 1.000
85 26 31 1.000
86 27 28 1.000
87 27 32 1.000
88 31 33 1.000
89 32 34 1.000
90 32 74 1.000
91 32 79 1.000
92 32 85 1.000
93 33 35 1.000
94 33 84 1.000
95 34 70 1.000
96 34 74 1.000
97 34 85 1.000
98 35 84 1.000
99 35 86 1.000
100 36 40 1.000
101 36 41 1.000
102 36 44 1.000
103 36 59 1.000
104 36 66 1.000
105 36 87 1.000
106 36 90 1.000
107 38 42 1.000
108 38 49 1.000
109 39 42 1.000
110 39 43 1.000
111 40 87 1.000
112 40 90 1.000
113 41 44 1.000
114 41 49 1.000
115 41 55 1.000
116 41 58 1.000
117 41 59 1.000
118 41 66 1.000
119 42 48 1.000
120 42 49 1.000
121 44 62 1.000
122 44 66 1.000
123 44 90 1.000
124 44 91 1.000
125 45 47 1.000
126 45 58 1.000
127 45 62 1.000
128 47 54 1.000
129 47 58 1.000
130 49 54 1.000
131 49 55 1.000
132 49 58 1.000
133 50 51 1.000
134 50 54 1.000
135 51 52 1.000
136 51 53 1.000
137 51 54 1.000
138 54 58 1.000
139 56 59 1.000
140 56 60 1.000
141 58 61 1.000
142 58 62 1.000
143 59 60 1.000
144 59 63 1.000
145 59 66 1.000
146 59 67 1.000
147 60 63 1.000
148 61 62 1.000
149 62 65 1.000
150 62 66 1.000
151 62 91 1.000
152 63 64 1.000
153 63 67 1.000
154 64 67 1.000
155 65 68 1.000
156 65 90 1.000
157 65 91 1.000
158 66 87 1.000
159 66 90 1.000
160 69 72 1.000
161 69 73 1.000
162 69 87 1.000
163 69 90 1.000
164 70 85 1.000
165 70 87 1.000
166 71 72 1.000
167 71 75 1.000
168 72 73 1.000
169 72 76 1.000
170 73 76 1.000
171 73 78 1.000
172 73 85 1.000
173 73 87 1.000
174 74 79 1.000
175 74 85 1.000
176 76 78 1.000
177 77 79 1.000
178 79 85 1.000
179 80 82 1.000
180 80 84 1.000
181 80 86 1.000
182 81 82 1.000
183 82 84 1.000
184 84 86 1.000
185 85 87 1.000
186 86 88 1.000
187 87 90 1.000
188 88 89 1.000
189 90 91 1.000