ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/3nulA_ALL_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 8956 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: SWQSYVDDHLXCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYXVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPXTGGQCNLVVERLGDYLIESEL
3 #PDB: 3nul
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: ALL
8 #CUTOFF: 5.0
9 1 2 1.000
10 1 3 1.000
11 1 4 1.000
12 1 5 1.000
13 2 3 1.000
14 2 4 1.000
15 2 5 1.000
16 2 6 1.000
17 2 24 1.000
18 2 32 1.000
19 2 33 1.000
20 2 125 1.000
21 2 130 1.000
22 3 4 1.000
23 3 5 1.000
24 3 6 1.000
25 3 7 1.000
26 3 8 1.000
27 3 33 1.000
28 3 34 1.000
29 3 35 1.000
30 4 5 1.000
31 4 6 1.000
32 4 7 1.000
33 4 8 1.000
34 4 9 1.000
35 5 6 1.000
36 5 7 1.000
37 5 8 1.000
38 5 9 1.000
39 5 10 1.000
40 5 24 1.000
41 5 121 1.000
42 5 124 1.000
43 5 125 1.000
44 5 130 1.000
45 6 7 1.000
46 6 8 1.000
47 6 9 1.000
48 6 10 1.000
49 6 22 1.000
50 6 23 1.000
51 6 24 1.000
52 6 33 1.000
53 6 34 1.000
54 6 35 1.000
55 7 8 1.000
56 7 9 1.000
57 7 10 1.000
58 7 12 1.000
59 8 9 1.000
60 8 10 1.000
61 8 12 1.000
62 9 10 1.000
63 9 12 1.000
64 9 117 1.000
65 9 120 1.000
66 9 121 1.000
67 10 12 1.000
68 10 19 1.000
69 10 22 1.000
70 10 23 1.000
71 10 24 1.000
72 10 101 1.000
73 10 102 1.000
74 10 117 1.000
75 10 118 1.000
76 10 121 1.000
77 12 13 1.000
78 12 14 1.000
79 12 17 1.000
80 12 18 1.000
81 12 19 1.000
82 12 120 1.000
83 13 14 1.000
84 13 15 1.000
85 13 16 1.000
86 13 17 1.000
87 13 18 1.000
88 14 15 1.000
89 14 16 1.000
90 14 17 1.000
91 14 18 1.000
92 14 113 1.000
93 14 117 1.000
94 15 16 1.000
95 15 17 1.000
96 15 113 1.000
97 16 17 1.000
98 16 18 1.000
99 17 18 1.000
100 17 19 1.000
101 17 108 1.000
102 17 113 1.000
103 18 19 1.000
104 18 20 1.000
105 19 20 1.000
106 19 21 1.000
107 19 22 1.000
108 19 102 1.000
109 19 103 1.000
110 19 104 1.000
111 19 105 1.000
112 19 114 1.000
113 19 117 1.000
114 19 118 1.000
115 20 21 1.000
116 20 22 1.000
117 20 35 1.000
118 20 37 1.000
119 20 104 1.000
120 20 105 1.000
121 20 106 1.000
122 21 22 1.000
123 21 23 1.000
124 21 35 1.000
125 21 37 1.000
126 21 38 1.000
127 21 39 1.000
128 21 102 1.000
129 21 103 1.000
130 21 104 1.000
131 22 23 1.000
132 22 24 1.000
133 22 33 1.000
134 22 34 1.000
135 22 35 1.000
136 22 38 1.000
137 22 102 1.000
138 22 103 1.000
139 22 104 1.000
140 23 24 1.000
141 23 25 1.000
142 23 33 1.000
143 23 34 1.000
144 23 35 1.000
145 23 38 1.000
146 23 100 1.000
147 23 101 1.000
148 23 102 1.000
149 24 25 1.000
150 24 26 1.000
151 24 30 1.000
152 24 31 1.000
153 24 32 1.000
154 24 33 1.000
155 24 34 1.000
156 24 99 1.000
157 24 100 1.000
158 24 101 1.000
159 24 102 1.000
160 24 121 1.000
161 24 125 1.000
162 25 26 1.000
163 25 27 1.000
164 25 29 1.000
165 25 30 1.000
166 25 31 1.000
167 25 32 1.000
168 25 33 1.000
169 25 38 1.000
170 25 41 1.000
171 25 46 1.000
172 25 98 1.000
173 25 99 1.000
174 25 100 1.000
175 25 102 1.000
176 26 27 1.000
177 26 28 1.000
178 26 29 1.000
179 26 30 1.000
180 26 32 1.000
181 26 98 1.000
182 26 99 1.000
183 26 100 1.000
184 27 28 1.000
185 27 29 1.000
186 27 46 1.000
187 27 50 1.000
188 27 95 1.000
189 27 96 1.000
190 27 97 1.000
191 27 98 1.000
192 27 99 1.000
193 27 100 1.000
194 28 29 1.000
195 28 30 1.000
196 28 32 1.000
197 28 46 1.000
198 28 50 1.000
199 29 30 1.000
200 29 31 1.000
201 29 46 1.000
202 30 31 1.000
203 30 32 1.000
204 31 32 1.000
205 31 33 1.000
206 31 34 1.000
207 32 33 1.000
208 32 34 1.000
209 32 98 1.000
210 32 99 1.000
211 33 34 1.000
212 33 35 1.000
213 34 35 1.000
214 34 36 1.000
215 34 38 1.000
216 35 36 1.000
217 35 37 1.000
218 35 38 1.000
219 36 37 1.000
220 36 38 1.000
221 37 38 1.000
222 37 39 1.000
223 38 39 1.000
224 38 40 1.000
225 38 41 1.000
226 38 102 1.000
227 38 104 1.000
228 39 40 1.000
229 39 41 1.000
230 39 67 1.000
231 39 104 1.000
232 40 41 1.000
233 40 42 1.000
234 40 45 1.000
235 40 67 1.000
236 41 42 1.000
237 41 43 1.000
238 41 45 1.000
239 41 46 1.000
240 41 66 1.000
241 41 67 1.000
242 41 102 1.000
243 41 104 1.000
244 42 43 1.000
245 42 44 1.000
246 42 45 1.000
247 42 46 1.000
248 42 67 1.000
249 42 68 1.000
250 43 44 1.000
251 43 45 1.000
252 43 46 1.000
253 43 47 1.000
254 44 45 1.000
255 44 46 1.000
256 44 47 1.000
257 44 48 1.000
258 45 46 1.000
259 45 47 1.000
260 45 48 1.000
261 45 49 1.000
262 45 65 1.000
263 45 66 1.000
264 45 67 1.000
265 45 68 1.000
266 45 69 1.000
267 46 47 1.000
268 46 48 1.000
269 46 49 1.000
270 46 50 1.000
271 46 100 1.000
272 47 48 1.000
273 47 49 1.000
274 47 50 1.000
275 47 51 1.000
276 47 52 1.000
277 48 49 1.000
278 48 50 1.000
279 48 51 1.000
280 48 52 1.000
281 48 58 1.000
282 48 59 1.000
283 49 50 1.000
284 49 51 1.000
285 49 52 1.000
286 49 53 1.000
287 49 59 1.000
288 49 64 1.000
289 49 66 1.000
290 49 82 1.000
291 49 93 1.000
292 49 100 1.000
293 49 102 1.000
294 50 51 1.000
295 50 52 1.000
296 50 53 1.000
297 50 54 1.000
298 50 100 1.000
299 51 52 1.000
300 51 53 1.000
301 51 54 1.000
302 51 55 1.000
303 51 56 1.000
304 51 58 1.000
305 52 53 1.000
306 52 54 1.000
307 52 55 1.000
308 52 56 1.000
309 52 57 1.000
310 52 58 1.000
311 52 59 1.000
312 52 60 1.000
313 52 82 1.000
314 53 54 1.000
315 53 55 1.000
316 53 56 1.000
317 53 78 1.000
318 53 79 1.000
319 53 80 1.000
320 53 81 1.000
321 53 82 1.000
322 53 93 1.000
323 53 94 1.000
324 53 95 1.000
325 53 100 1.000
326 54 55 1.000
327 54 56 1.000
328 55 56 1.000
329 55 57 1.000
330 55 58 1.000
331 56 57 1.000
332 56 58 1.000
333 56 78 1.000
334 56 79 1.000
335 57 58 1.000
336 57 59 1.000
337 57 60 1.000
338 57 61 1.000
339 58 59 1.000
340 58 60 1.000
341 58 61 1.000
342 59 60 1.000
343 59 61 1.000
344 59 62 1.000
345 59 63 1.000
346 59 64 1.000
347 59 73 1.000
348 59 82 1.000
349 60 61 1.000
350 60 62 1.000
351 60 63 1.000
352 60 73 1.000
353 61 62 1.000
354 61 63 1.000
355 62 63 1.000
356 62 64 1.000
357 62 65 1.000
358 62 70 1.000
359 63 64 1.000
360 63 65 1.000
361 63 70 1.000
362 63 71 1.000
363 63 73 1.000
364 64 65 1.000
365 64 66 1.000
366 64 69 1.000
367 64 70 1.000
368 64 71 1.000
369 64 73 1.000
370 64 82 1.000
371 64 83 1.000
372 64 84 1.000
373 64 91 1.000
374 64 93 1.000
375 65 66 1.000
376 65 67 1.000
377 65 68 1.000
378 65 69 1.000
379 65 70 1.000
380 65 71 1.000
381 66 67 1.000
382 66 68 1.000
383 66 69 1.000
384 66 71 1.000
385 66 91 1.000
386 66 93 1.000
387 66 102 1.000
388 66 104 1.000
389 67 68 1.000
390 67 69 1.000
391 68 69 1.000
392 68 70 1.000
393 69 70 1.000
394 69 71 1.000
395 69 86 1.000
396 70 71 1.000
397 70 85 1.000
398 70 86 1.000
399 71 73 1.000
400 71 84 1.000
401 71 85 1.000
402 71 86 1.000
403 71 90 1.000
404 71 91 1.000
405 71 104 1.000
406 73 74 1.000
407 73 75 1.000
408 73 83 1.000
409 73 84 1.000
410 74 75 1.000
411 74 76 1.000
412 74 83 1.000
413 74 84 1.000
414 74 85 1.000
415 75 76 1.000
416 75 77 1.000
417 75 83 1.000
418 76 77 1.000
419 76 78 1.000
420 76 81 1.000
421 76 82 1.000
422 76 83 1.000
423 77 78 1.000
424 77 79 1.000
425 77 80 1.000
426 77 81 1.000
427 77 83 1.000
428 77 94 1.000
429 77 119 1.000
430 78 79 1.000
431 78 80 1.000
432 79 80 1.000
433 79 81 1.000
434 79 95 1.000
435 80 81 1.000
436 80 82 1.000
437 80 93 1.000
438 80 94 1.000
439 80 95 1.000
440 81 82 1.000
441 81 83 1.000
442 81 92 1.000
443 81 93 1.000
444 81 94 1.000
445 81 119 1.000
446 82 83 1.000
447 82 84 1.000
448 82 91 1.000
449 82 92 1.000
450 82 93 1.000
451 83 84 1.000
452 83 85 1.000
453 83 91 1.000
454 83 92 1.000
455 83 115 1.000
456 83 119 1.000
457 84 85 1.000
458 84 86 1.000
459 84 89 1.000
460 84 90 1.000
461 84 91 1.000
462 84 105 1.000
463 85 86 1.000
464 85 87 1.000
465 85 88 1.000
466 85 89 1.000
467 85 90 1.000
468 85 91 1.000
469 85 105 1.000
470 86 87 1.000
471 86 88 1.000
472 86 89 1.000
473 86 90 1.000
474 87 88 1.000
475 87 89 1.000
476 88 89 1.000
477 88 90 1.000
478 88 105 1.000
479 88 106 1.000
480 88 107 1.000
481 89 90 1.000
482 89 91 1.000
483 89 105 1.000
484 89 106 1.000
485 89 107 1.000
486 90 91 1.000
487 90 92 1.000
488 90 103 1.000
489 90 104 1.000
490 90 105 1.000
491 91 92 1.000
492 91 93 1.000
493 91 103 1.000
494 91 104 1.000
495 91 105 1.000
496 91 114 1.000
497 92 93 1.000
498 92 94 1.000
499 92 101 1.000
500 92 102 1.000
501 92 103 1.000
502 92 111 1.000
503 92 114 1.000
504 92 115 1.000
505 92 118 1.000
506 92 119 1.000
507 93 94 1.000
508 93 95 1.000
509 93 100 1.000
510 93 101 1.000
511 93 102 1.000
512 93 118 1.000
513 94 95 1.000
514 94 96 1.000
515 94 99 1.000
516 94 100 1.000
517 94 101 1.000
518 94 118 1.000
519 94 119 1.000
520 94 122 1.000
521 94 123 1.000
522 94 126 1.000
523 95 96 1.000
524 95 97 1.000
525 95 99 1.000
526 95 100 1.000
527 95 126 1.000
528 96 97 1.000
529 96 98 1.000
530 96 99 1.000
531 96 100 1.000
532 96 101 1.000
533 96 122 1.000
534 96 125 1.000
535 96 126 1.000
536 96 130 1.000
537 97 98 1.000
538 97 99 1.000
539 97 125 1.000
540 97 126 1.000
541 97 129 1.000
542 97 130 1.000
543 98 99 1.000
544 98 100 1.000
545 98 129 1.000
546 98 130 1.000
547 99 100 1.000
548 99 101 1.000
549 99 130 1.000
550 100 101 1.000
551 100 102 1.000
552 101 102 1.000
553 101 103 1.000
554 101 118 1.000
555 101 121 1.000
556 101 122 1.000
557 101 125 1.000
558 102 103 1.000
559 102 104 1.000
560 102 118 1.000
561 103 104 1.000
562 103 105 1.000
563 103 114 1.000
564 103 118 1.000
565 104 105 1.000
566 104 106 1.000
567 104 114 1.000
568 105 106 1.000
569 105 107 1.000
570 105 110 1.000
571 105 111 1.000
572 105 114 1.000
573 106 107 1.000
574 106 108 1.000
575 107 108 1.000
576 108 110 1.000
577 108 113 1.000
578 110 111 1.000
579 110 112 1.000
580 110 113 1.000
581 110 114 1.000
582 110 115 1.000
583 111 112 1.000
584 111 113 1.000
585 111 114 1.000
586 111 115 1.000
587 111 116 1.000
588 112 113 1.000
589 112 114 1.000
590 112 115 1.000
591 112 116 1.000
592 113 114 1.000
593 113 115 1.000
594 113 116 1.000
595 113 117 1.000
596 114 115 1.000
597 114 116 1.000
598 114 117 1.000
599 114 118 1.000
600 114 119 1.000
601 115 116 1.000
602 115 117 1.000
603 115 118 1.000
604 115 119 1.000
605 115 120 1.000
606 116 117 1.000
607 116 118 1.000
608 116 119 1.000
609 116 120 1.000
610 116 121 1.000
611 117 118 1.000
612 117 119 1.000
613 117 120 1.000
614 117 121 1.000
615 118 119 1.000
616 118 120 1.000
617 118 121 1.000
618 118 122 1.000
619 119 120 1.000
620 119 121 1.000
621 119 122 1.000
622 119 123 1.000
623 119 124 1.000
624 120 121 1.000
625 120 122 1.000
626 120 123 1.000
627 120 124 1.000
628 121 122 1.000
629 121 123 1.000
630 121 124 1.000
631 121 125 1.000
632 121 126 1.000
633 122 123 1.000
634 122 124 1.000
635 122 125 1.000
636 122 126 1.000
637 123 124 1.000
638 123 125 1.000
639 123 126 1.000
640 123 127 1.000
641 123 128 1.000
642 124 125 1.000
643 124 126 1.000
644 124 127 1.000
645 124 128 1.000
646 125 126 1.000
647 125 127 1.000
648 125 128 1.000
649 125 129 1.000
650 125 130 1.000
651 126 127 1.000
652 126 128 1.000
653 126 129 1.000
654 126 130 1.000
655 127 128 1.000
656 127 129 1.000
657 128 129 1.000
658 128 130 1.000
659 129 130 1.000