ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/3nulA_BB:SC_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 8153 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: SWQSYVDDHLXCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYXVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPXTGGQCNLVVERLGDYLIESEL
3 #PDB: 3nul
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: BB/SC
8 #CUTOFF: 5.0
9 1 2 1.000
10 1 4 1.000
11 1 5 1.000
12 2 1 1.000
13 2 3 1.000
14 2 5 1.000
15 2 6 1.000
16 2 24 1.000
17 2 33 1.000
18 3 1 1.000
19 3 2 1.000
20 3 4 1.000
21 3 6 1.000
22 3 7 1.000
23 3 33 1.000
24 4 1 1.000
25 4 3 1.000
26 4 5 1.000
27 4 7 1.000
28 4 8 1.000
29 4 9 1.000
30 5 1 1.000
31 5 4 1.000
32 5 6 1.000
33 5 9 1.000
34 5 10 1.000
35 5 24 1.000
36 5 121 1.000
37 6 5 1.000
38 6 7 1.000
39 6 10 1.000
40 6 24 1.000
41 7 3 1.000
42 7 6 1.000
43 7 8 1.000
44 7 12 1.000
45 8 4 1.000
46 8 7 1.000
47 8 9 1.000
48 8 12 1.000
49 9 8 1.000
50 9 10 1.000
51 9 12 1.000
52 9 117 1.000
53 9 120 1.000
54 10 9 1.000
55 10 12 1.000
56 10 19 1.000
57 10 22 1.000
58 10 117 1.000
59 10 121 1.000
60 12 13 1.000
61 12 14 1.000
62 12 18 1.000
63 13 12 1.000
64 13 14 1.000
65 13 18 1.000
66 14 13 1.000
67 14 15 1.000
68 14 17 1.000
69 14 113 1.000
70 15 14 1.000
71 15 17 1.000
72 16 13 1.000
73 16 15 1.000
74 16 17 1.000
75 17 13 1.000
76 17 14 1.000
77 17 18 1.000
78 18 13 1.000
79 18 17 1.000
80 18 19 1.000
81 18 20 1.000
82 19 18 1.000
83 19 20 1.000
84 19 105 1.000
85 20 18 1.000
86 20 19 1.000
87 20 21 1.000
88 20 35 1.000
89 20 37 1.000
90 20 106 1.000
91 21 19 1.000
92 21 20 1.000
93 21 22 1.000
94 21 35 1.000
95 21 38 1.000
96 21 104 1.000
97 22 6 1.000
98 22 10 1.000
99 22 19 1.000
100 22 21 1.000
101 22 23 1.000
102 22 34 1.000
103 22 35 1.000
104 22 38 1.000
105 23 6 1.000
106 23 10 1.000
107 23 22 1.000
108 23 24 1.000
109 23 25 1.000
110 23 34 1.000
111 23 38 1.000
112 23 101 1.000
113 23 102 1.000
114 24 6 1.000
115 24 23 1.000
116 24 25 1.000
117 24 31 1.000
118 24 32 1.000
119 25 24 1.000
120 25 32 1.000
121 25 99 1.000
122 25 100 1.000
123 25 102 1.000
124 26 25 1.000
125 26 27 1.000
126 26 28 1.000
127 26 32 1.000
128 26 99 1.000
129 26 100 1.000
130 27 28 1.000
131 27 46 1.000
132 27 50 1.000
133 27 100 1.000
134 28 27 1.000
135 28 30 1.000
136 28 46 1.000
137 28 50 1.000
138 29 25 1.000
139 29 28 1.000
140 29 30 1.000
141 29 31 1.000
142 29 46 1.000
143 30 25 1.000
144 30 28 1.000
145 30 31 1.000
146 30 32 1.000
147 31 25 1.000
148 31 30 1.000
149 31 32 1.000
150 32 2 1.000
151 32 31 1.000
152 32 33 1.000
153 33 2 1.000
154 33 3 1.000
155 33 6 1.000
156 33 23 1.000
157 33 24 1.000
158 33 25 1.000
159 33 31 1.000
160 33 32 1.000
161 33 34 1.000
162 34 3 1.000
163 34 6 1.000
164 34 23 1.000
165 34 31 1.000
166 34 33 1.000
167 34 35 1.000
168 34 38 1.000
169 35 3 1.000
170 35 6 1.000
171 35 34 1.000
172 35 36 1.000
173 35 38 1.000
174 36 35 1.000
175 36 37 1.000
176 37 21 1.000
177 37 35 1.000
178 37 36 1.000
179 37 38 1.000
180 37 39 1.000
181 38 21 1.000
182 38 34 1.000
183 38 35 1.000
184 38 37 1.000
185 38 39 1.000
186 39 38 1.000
187 39 40 1.000
188 39 41 1.000
189 40 39 1.000
190 40 41 1.000
191 40 45 1.000
192 41 40 1.000
193 41 42 1.000
194 41 43 1.000
195 41 45 1.000
196 41 46 1.000
197 42 41 1.000
198 42 43 1.000
199 42 44 1.000
200 42 45 1.000
201 42 46 1.000
202 43 42 1.000
203 43 44 1.000
204 43 46 1.000
205 43 47 1.000
206 44 42 1.000
207 44 43 1.000
208 44 45 1.000
209 44 47 1.000
210 45 42 1.000
211 45 44 1.000
212 45 46 1.000
213 45 47 1.000
214 45 49 1.000
215 46 45 1.000
216 46 47 1.000
217 46 49 1.000
218 46 50 1.000
219 47 46 1.000
220 47 50 1.000
221 47 51 1.000
222 48 47 1.000
223 48 49 1.000
224 48 51 1.000
225 48 52 1.000
226 48 58 1.000
227 48 59 1.000
228 49 50 1.000
229 49 52 1.000
230 49 53 1.000
231 49 59 1.000
232 49 82 1.000
233 50 49 1.000
234 50 51 1.000
235 50 53 1.000
236 50 54 1.000
237 51 50 1.000
238 51 52 1.000
239 51 54 1.000
240 51 55 1.000
241 51 58 1.000
242 52 51 1.000
243 52 53 1.000
244 52 56 1.000
245 52 58 1.000
246 52 59 1.000
247 52 82 1.000
248 53 52 1.000
249 53 54 1.000
250 53 56 1.000
251 53 82 1.000
252 54 53 1.000
253 54 55 1.000
254 54 56 1.000
255 55 52 1.000
256 55 54 1.000
257 55 56 1.000
258 55 58 1.000
259 56 52 1.000
260 56 55 1.000
261 56 78 1.000
262 57 52 1.000
263 57 56 1.000
264 57 58 1.000
265 57 60 1.000
266 57 61 1.000
267 58 52 1.000
268 58 59 1.000
269 58 61 1.000
270 59 52 1.000
271 59 58 1.000
272 59 60 1.000
273 59 61 1.000
274 59 62 1.000
275 59 73 1.000
276 60 52 1.000
277 60 59 1.000
278 60 61 1.000
279 60 73 1.000
280 61 60 1.000
281 61 62 1.000
282 62 61 1.000
283 62 65 1.000
284 62 70 1.000
285 63 59 1.000
286 63 62 1.000
287 63 64 1.000
288 63 65 1.000
289 63 70 1.000
290 63 73 1.000
291 64 59 1.000
292 64 65 1.000
293 64 66 1.000
294 64 70 1.000
295 64 71 1.000
296 64 73 1.000
297 65 45 1.000
298 65 64 1.000
299 65 66 1.000
300 66 41 1.000
301 66 45 1.000
302 66 65 1.000
303 66 69 1.000
304 66 71 1.000
305 67 39 1.000
306 67 41 1.000
307 67 42 1.000
308 67 45 1.000
309 67 66 1.000
310 67 69 1.000
311 68 42 1.000
312 68 45 1.000
313 68 65 1.000
314 68 69 1.000
315 69 45 1.000
316 69 65 1.000
317 69 66 1.000
318 69 70 1.000
319 69 71 1.000
320 69 86 1.000
321 70 65 1.000
322 70 69 1.000
323 70 71 1.000
324 70 86 1.000
325 71 64 1.000
326 71 70 1.000
327 71 73 1.000
328 71 86 1.000
329 73 74 1.000
330 74 73 1.000
331 74 75 1.000
332 74 83 1.000
333 75 74 1.000
334 75 83 1.000
335 76 75 1.000
336 76 77 1.000
337 76 81 1.000
338 76 83 1.000
339 77 78 1.000
340 77 80 1.000
341 77 81 1.000
342 77 83 1.000
343 78 56 1.000
344 78 77 1.000
345 78 80 1.000
346 79 53 1.000
347 79 56 1.000
348 79 78 1.000
349 79 80 1.000
350 79 95 1.000
351 80 53 1.000
352 80 77 1.000
353 80 81 1.000
354 80 94 1.000
355 80 95 1.000
356 81 53 1.000
357 81 77 1.000
358 81 80 1.000
359 81 82 1.000
360 81 83 1.000
361 82 53 1.000
362 82 81 1.000
363 82 83 1.000
364 82 92 1.000
365 82 93 1.000
366 83 64 1.000
367 83 73 1.000
368 83 74 1.000
369 83 81 1.000
370 83 82 1.000
371 83 91 1.000
372 84 64 1.000
373 84 71 1.000
374 84 74 1.000
375 84 83 1.000
376 84 85 1.000
377 84 91 1.000
378 84 105 1.000
379 85 71 1.000
380 85 74 1.000
381 85 86 1.000
382 86 71 1.000
383 86 85 1.000
384 86 88 1.000
385 87 85 1.000
386 87 86 1.000
387 87 88 1.000
388 88 85 1.000
389 88 105 1.000
390 88 107 1.000
391 89 85 1.000
392 89 86 1.000
393 89 88 1.000
394 89 105 1.000
395 89 106 1.000
396 90 71 1.000
397 90 85 1.000
398 90 91 1.000
399 90 104 1.000
400 90 105 1.000
401 91 71 1.000
402 91 83 1.000
403 91 92 1.000
404 91 104 1.000
405 91 105 1.000
406 91 114 1.000
407 92 83 1.000
408 92 91 1.000
409 92 93 1.000
410 92 102 1.000
411 92 114 1.000
412 92 115 1.000
413 92 118 1.000
414 93 53 1.000
415 93 81 1.000
416 93 82 1.000
417 93 91 1.000
418 93 92 1.000
419 93 94 1.000
420 93 118 1.000
421 94 53 1.000
422 94 81 1.000
423 94 92 1.000
424 94 93 1.000
425 94 95 1.000
426 94 96 1.000
427 94 100 1.000
428 94 101 1.000
429 94 118 1.000
430 95 53 1.000
431 95 94 1.000
432 95 96 1.000
433 95 100 1.000
434 95 126 1.000
435 96 27 1.000
436 96 95 1.000
437 96 97 1.000
438 96 126 1.000
439 97 27 1.000
440 97 96 1.000
441 97 98 1.000
442 97 126 1.000
443 98 27 1.000
444 98 32 1.000
445 98 96 1.000
446 98 97 1.000
447 98 99 1.000
448 99 27 1.000
449 99 32 1.000
450 99 95 1.000
451 99 96 1.000
452 99 98 1.000
453 99 100 1.000
454 100 24 1.000
455 100 25 1.000
456 100 27 1.000
457 100 96 1.000
458 100 99 1.000
459 100 101 1.000
460 100 102 1.000
461 101 24 1.000
462 101 93 1.000
463 101 94 1.000
464 101 100 1.000
465 101 102 1.000
466 101 118 1.000
467 102 10 1.000
468 102 19 1.000
469 102 22 1.000
470 102 23 1.000
471 102 38 1.000
472 102 93 1.000
473 102 101 1.000
474 102 118 1.000
475 103 19 1.000
476 103 22 1.000
477 103 91 1.000
478 103 92 1.000
479 103 102 1.000
480 103 104 1.000
481 103 114 1.000
482 103 118 1.000
483 104 19 1.000
484 104 20 1.000
485 104 91 1.000
486 104 105 1.000
487 104 114 1.000
488 105 19 1.000
489 105 20 1.000
490 105 104 1.000
491 105 106 1.000
492 105 114 1.000
493 106 20 1.000
494 106 105 1.000
495 106 107 1.000
496 106 108 1.000
497 107 105 1.000
498 107 106 1.000
499 107 108 1.000
500 108 17 1.000
501 108 107 1.000
502 108 110 1.000
503 108 113 1.000
504 110 105 1.000
505 110 113 1.000
506 110 114 1.000
507 111 92 1.000
508 111 105 1.000
509 111 110 1.000
510 111 114 1.000
511 111 115 1.000
512 112 110 1.000
513 112 113 1.000
514 112 115 1.000
515 112 116 1.000
516 113 110 1.000
517 113 114 1.000
518 113 116 1.000
519 113 117 1.000
520 114 19 1.000
521 114 92 1.000
522 114 105 1.000
523 114 113 1.000
524 114 115 1.000
525 114 117 1.000
526 114 118 1.000
527 115 92 1.000
528 115 114 1.000
529 115 116 1.000
530 115 118 1.000
531 115 119 1.000
532 116 115 1.000
533 116 117 1.000
534 116 119 1.000
535 116 120 1.000
536 117 10 1.000
537 117 116 1.000
538 117 118 1.000
539 117 120 1.000
540 117 121 1.000
541 118 10 1.000
542 118 94 1.000
543 118 101 1.000
544 118 117 1.000
545 118 119 1.000
546 118 121 1.000
547 119 94 1.000
548 119 118 1.000
549 119 120 1.000
550 119 123 1.000
551 120 119 1.000
552 120 121 1.000
553 120 123 1.000
554 120 124 1.000
555 121 120 1.000
556 121 124 1.000
557 121 125 1.000
558 122 94 1.000
559 122 96 1.000
560 122 101 1.000
561 122 121 1.000
562 122 123 1.000
563 122 125 1.000
564 122 126 1.000
565 123 94 1.000
566 123 124 1.000
567 123 126 1.000
568 123 127 1.000
569 124 123 1.000
570 124 125 1.000
571 124 127 1.000
572 124 128 1.000
573 125 96 1.000
574 125 97 1.000
575 125 124 1.000
576 125 126 1.000
577 125 128 1.000
578 125 130 1.000
579 126 96 1.000
580 126 97 1.000
581 126 125 1.000
582 126 127 1.000
583 126 129 1.000
584 127 126 1.000
585 127 128 1.000
586 127 129 1.000
587 128 127 1.000
588 128 129 1.000
589 128 130 1.000
590 129 97 1.000
591 129 98 1.000
592 129 128 1.000
593 129 130 1.000
594 130 96 1.000
595 130 97 1.000
596 130 98 1.000
597 130 99 1.000
598 130 125 1.000
599 130 126 1.000
600 130 128 1.000
601 130 129 1.000