ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/3nulA_BB_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 6580 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: SWQSYVDDHLXCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYXVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPXTGGQCNLVVERLGDYLIESEL
3 #PDB: 3nul
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: BB
8 #CUTOFF: 5.0
9 1 2 1.000
10 1 3 1.000
11 1 4 1.000
12 1 5 1.000
13 2 3 1.000
14 2 4 1.000
15 2 5 1.000
16 2 6 1.000
17 2 33 1.000
18 3 4 1.000
19 3 5 1.000
20 3 6 1.000
21 3 7 1.000
22 3 8 1.000
23 4 5 1.000
24 4 6 1.000
25 4 7 1.000
26 4 8 1.000
27 4 9 1.000
28 5 6 1.000
29 5 7 1.000
30 5 8 1.000
31 5 9 1.000
32 5 10 1.000
33 6 7 1.000
34 6 8 1.000
35 6 9 1.000
36 6 10 1.000
37 7 8 1.000
38 7 9 1.000
39 7 10 1.000
40 7 12 1.000
41 8 9 1.000
42 8 10 1.000
43 8 12 1.000
44 9 10 1.000
45 9 12 1.000
46 9 117 1.000
47 10 12 1.000
48 10 19 1.000
49 12 13 1.000
50 12 14 1.000
51 12 17 1.000
52 12 18 1.000
53 12 19 1.000
54 13 14 1.000
55 13 15 1.000
56 13 16 1.000
57 13 17 1.000
58 13 18 1.000
59 14 15 1.000
60 14 16 1.000
61 14 17 1.000
62 14 18 1.000
63 15 16 1.000
64 15 17 1.000
65 16 17 1.000
66 16 18 1.000
67 17 18 1.000
68 17 19 1.000
69 18 19 1.000
70 18 20 1.000
71 19 20 1.000
72 19 21 1.000
73 19 104 1.000
74 19 105 1.000
75 20 21 1.000
76 20 22 1.000
77 20 104 1.000
78 20 105 1.000
79 21 22 1.000
80 21 23 1.000
81 21 37 1.000
82 21 38 1.000
83 21 102 1.000
84 21 103 1.000
85 21 104 1.000
86 22 23 1.000
87 22 24 1.000
88 22 33 1.000
89 22 34 1.000
90 22 35 1.000
91 22 102 1.000
92 22 103 1.000
93 22 104 1.000
94 23 24 1.000
95 23 25 1.000
96 23 33 1.000
97 23 34 1.000
98 23 35 1.000
99 23 100 1.000
100 23 101 1.000
101 23 102 1.000
102 24 25 1.000
103 24 26 1.000
104 24 30 1.000
105 24 31 1.000
106 24 32 1.000
107 24 33 1.000
108 24 34 1.000
109 24 100 1.000
110 24 101 1.000
111 24 102 1.000
112 25 26 1.000
113 25 27 1.000
114 25 30 1.000
115 25 31 1.000
116 25 32 1.000
117 25 98 1.000
118 25 99 1.000
119 25 100 1.000
120 26 27 1.000
121 26 28 1.000
122 26 29 1.000
123 26 30 1.000
124 26 32 1.000
125 26 98 1.000
126 26 99 1.000
127 26 100 1.000
128 27 28 1.000
129 27 29 1.000
130 27 98 1.000
131 27 99 1.000
132 27 100 1.000
133 28 29 1.000
134 28 30 1.000
135 29 30 1.000
136 29 31 1.000
137 30 31 1.000
138 30 32 1.000
139 31 32 1.000
140 31 33 1.000
141 32 33 1.000
142 32 34 1.000
143 33 34 1.000
144 33 35 1.000
145 34 35 1.000
146 34 36 1.000
147 35 36 1.000
148 35 37 1.000
149 35 38 1.000
150 36 37 1.000
151 36 38 1.000
152 37 38 1.000
153 37 39 1.000
154 38 39 1.000
155 38 40 1.000
156 39 40 1.000
157 39 41 1.000
158 40 41 1.000
159 40 42 1.000
160 40 67 1.000
161 41 42 1.000
162 41 43 1.000
163 41 67 1.000
164 42 43 1.000
165 42 44 1.000
166 42 45 1.000
167 42 46 1.000
168 42 67 1.000
169 43 44 1.000
170 43 45 1.000
171 43 46 1.000
172 43 47 1.000
173 44 45 1.000
174 44 46 1.000
175 44 47 1.000
176 44 48 1.000
177 45 46 1.000
178 45 47 1.000
179 45 48 1.000
180 45 49 1.000
181 45 65 1.000
182 46 47 1.000
183 46 48 1.000
184 46 49 1.000
185 46 50 1.000
186 47 48 1.000
187 47 49 1.000
188 47 50 1.000
189 47 51 1.000
190 47 52 1.000
191 48 49 1.000
192 48 50 1.000
193 48 51 1.000
194 48 52 1.000
195 49 50 1.000
196 49 51 1.000
197 49 52 1.000
198 49 53 1.000
199 50 51 1.000
200 50 52 1.000
201 50 53 1.000
202 50 54 1.000
203 51 52 1.000
204 51 53 1.000
205 51 54 1.000
206 51 55 1.000
207 51 56 1.000
208 52 53 1.000
209 52 54 1.000
210 52 55 1.000
211 52 56 1.000
212 52 57 1.000
213 52 58 1.000
214 53 54 1.000
215 53 55 1.000
216 53 56 1.000
217 53 78 1.000
218 53 79 1.000
219 54 55 1.000
220 54 56 1.000
221 55 56 1.000
222 55 57 1.000
223 55 58 1.000
224 56 57 1.000
225 56 58 1.000
226 57 58 1.000
227 57 59 1.000
228 57 60 1.000
229 57 61 1.000
230 58 59 1.000
231 58 60 1.000
232 58 61 1.000
233 59 60 1.000
234 59 61 1.000
235 59 62 1.000
236 59 63 1.000
237 59 64 1.000
238 60 61 1.000
239 60 62 1.000
240 60 63 1.000
241 61 62 1.000
242 61 63 1.000
243 62 63 1.000
244 62 64 1.000
245 63 64 1.000
246 63 65 1.000
247 63 71 1.000
248 63 73 1.000
249 64 65 1.000
250 64 66 1.000
251 64 69 1.000
252 64 70 1.000
253 64 71 1.000
254 64 73 1.000
255 65 66 1.000
256 65 67 1.000
257 65 68 1.000
258 65 69 1.000
259 65 70 1.000
260 65 71 1.000
261 66 67 1.000
262 66 68 1.000
263 66 69 1.000
264 67 68 1.000
265 67 69 1.000
266 68 69 1.000
267 68 70 1.000
268 69 70 1.000
269 69 71 1.000
270 70 71 1.000
271 70 85 1.000
272 70 86 1.000
273 71 73 1.000
274 71 84 1.000
275 71 85 1.000
276 73 74 1.000
277 73 75 1.000
278 73 83 1.000
279 73 84 1.000
280 74 75 1.000
281 74 76 1.000
282 74 83 1.000
283 74 84 1.000
284 75 76 1.000
285 75 77 1.000
286 75 83 1.000
287 76 77 1.000
288 76 78 1.000
289 76 81 1.000
290 76 82 1.000
291 76 83 1.000
292 77 78 1.000
293 77 79 1.000
294 77 80 1.000
295 77 81 1.000
296 78 79 1.000
297 78 80 1.000
298 79 80 1.000
299 79 81 1.000
300 80 81 1.000
301 80 82 1.000
302 80 93 1.000
303 80 94 1.000
304 80 95 1.000
305 81 82 1.000
306 81 83 1.000
307 81 93 1.000
308 81 94 1.000
309 82 83 1.000
310 82 84 1.000
311 82 91 1.000
312 82 92 1.000
313 82 93 1.000
314 83 84 1.000
315 83 85 1.000
316 83 91 1.000
317 83 92 1.000
318 84 85 1.000
319 84 86 1.000
320 84 89 1.000
321 84 90 1.000
322 84 91 1.000
323 85 86 1.000
324 85 87 1.000
325 85 89 1.000
326 85 90 1.000
327 85 91 1.000
328 86 87 1.000
329 86 88 1.000
330 86 89 1.000
331 86 90 1.000
332 87 88 1.000
333 87 89 1.000
334 88 89 1.000
335 88 90 1.000
336 88 106 1.000
337 88 107 1.000
338 89 90 1.000
339 89 91 1.000
340 89 105 1.000
341 89 106 1.000
342 89 107 1.000
343 90 91 1.000
344 90 92 1.000
345 90 103 1.000
346 90 104 1.000
347 90 105 1.000
348 91 92 1.000
349 91 93 1.000
350 91 103 1.000
351 91 104 1.000
352 91 105 1.000
353 92 93 1.000
354 92 94 1.000
355 92 101 1.000
356 92 102 1.000
357 92 103 1.000
358 93 94 1.000
359 93 95 1.000
360 93 101 1.000
361 93 102 1.000
362 94 95 1.000
363 94 96 1.000
364 94 99 1.000
365 94 100 1.000
366 94 101 1.000
367 95 96 1.000
368 95 97 1.000
369 95 99 1.000
370 95 100 1.000
371 96 97 1.000
372 96 98 1.000
373 96 99 1.000
374 96 100 1.000
375 96 130 1.000
376 97 98 1.000
377 97 99 1.000
378 97 130 1.000
379 98 99 1.000
380 98 100 1.000
381 98 130 1.000
382 99 100 1.000
383 99 101 1.000
384 99 130 1.000
385 100 101 1.000
386 100 102 1.000
387 101 102 1.000
388 101 103 1.000
389 102 103 1.000
390 102 104 1.000
391 103 104 1.000
392 103 105 1.000
393 104 105 1.000
394 104 106 1.000
395 105 106 1.000
396 105 107 1.000
397 106 107 1.000
398 106 108 1.000
399 107 108 1.000
400 108 110 1.000
401 110 111 1.000
402 110 112 1.000
403 110 113 1.000
404 110 114 1.000
405 110 115 1.000
406 111 112 1.000
407 111 113 1.000
408 111 114 1.000
409 111 115 1.000
410 111 116 1.000
411 112 113 1.000
412 112 114 1.000
413 112 115 1.000
414 112 116 1.000
415 113 114 1.000
416 113 115 1.000
417 113 116 1.000
418 113 117 1.000
419 114 115 1.000
420 114 116 1.000
421 114 117 1.000
422 114 118 1.000
423 114 119 1.000
424 115 116 1.000
425 115 117 1.000
426 115 118 1.000
427 115 119 1.000
428 115 120 1.000
429 116 117 1.000
430 116 118 1.000
431 116 119 1.000
432 116 120 1.000
433 116 121 1.000
434 117 118 1.000
435 117 119 1.000
436 117 120 1.000
437 117 121 1.000
438 118 119 1.000
439 118 120 1.000
440 118 121 1.000
441 118 122 1.000
442 119 120 1.000
443 119 121 1.000
444 119 122 1.000
445 119 123 1.000
446 119 124 1.000
447 120 121 1.000
448 120 122 1.000
449 120 123 1.000
450 120 124 1.000
451 121 122 1.000
452 121 123 1.000
453 121 124 1.000
454 121 125 1.000
455 121 126 1.000
456 122 123 1.000
457 122 124 1.000
458 122 125 1.000
459 122 126 1.000
460 123 124 1.000
461 123 125 1.000
462 123 126 1.000
463 123 127 1.000
464 123 128 1.000
465 124 125 1.000
466 124 126 1.000
467 124 127 1.000
468 124 128 1.000
469 125 126 1.000
470 125 127 1.000
471 125 128 1.000
472 125 129 1.000
473 125 130 1.000
474 126 127 1.000
475 126 128 1.000
476 126 129 1.000
477 126 130 1.000
478 127 128 1.000
479 127 129 1.000
480 128 129 1.000
481 128 130 1.000
482 129 130 1.000