ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/3nulA_Ca_8.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 3 months ago) by duarte
File size: 8236 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: SWQSYVDDHLXCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYXVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPXTGGQCNLVVERLGDYLIESEL
3 #PDB: 3nul
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: Ca
8 #CUTOFF: 8.0
9 1 2 1.000
10 1 3 1.000
11 1 4 1.000
12 1 5 1.000
13 2 3 1.000
14 2 4 1.000
15 2 5 1.000
16 2 6 1.000
17 2 24 1.000
18 2 32 1.000
19 2 33 1.000
20 3 4 1.000
21 3 5 1.000
22 3 6 1.000
23 3 7 1.000
24 3 32 1.000
25 3 33 1.000
26 3 34 1.000
27 4 5 1.000
28 4 6 1.000
29 4 7 1.000
30 4 8 1.000
31 4 9 1.000
32 5 6 1.000
33 5 7 1.000
34 5 8 1.000
35 5 9 1.000
36 5 10 1.000
37 5 121 1.000
38 6 7 1.000
39 6 8 1.000
40 6 9 1.000
41 6 10 1.000
42 6 22 1.000
43 6 23 1.000
44 6 24 1.000
45 6 33 1.000
46 6 34 1.000
47 6 35 1.000
48 7 8 1.000
49 7 9 1.000
50 7 10 1.000
51 7 12 1.000
52 7 35 1.000
53 8 9 1.000
54 8 10 1.000
55 8 12 1.000
56 9 10 1.000
57 9 12 1.000
58 9 117 1.000
59 9 121 1.000
60 10 12 1.000
61 10 19 1.000
62 10 22 1.000
63 10 103 1.000
64 10 117 1.000
65 10 118 1.000
66 10 121 1.000
67 12 13 1.000
68 12 14 1.000
69 12 18 1.000
70 12 19 1.000
71 13 14 1.000
72 13 15 1.000
73 13 16 1.000
74 13 17 1.000
75 13 18 1.000
76 13 19 1.000
77 14 15 1.000
78 14 16 1.000
79 14 17 1.000
80 14 18 1.000
81 14 113 1.000
82 15 16 1.000
83 15 17 1.000
84 16 17 1.000
85 16 18 1.000
86 17 18 1.000
87 17 19 1.000
88 17 108 1.000
89 18 19 1.000
90 18 20 1.000
91 18 105 1.000
92 19 20 1.000
93 19 21 1.000
94 19 22 1.000
95 19 103 1.000
96 19 104 1.000
97 19 105 1.000
98 19 106 1.000
99 19 114 1.000
100 20 21 1.000
101 20 22 1.000
102 20 37 1.000
103 20 103 1.000
104 20 104 1.000
105 20 105 1.000
106 20 106 1.000
107 21 22 1.000
108 21 23 1.000
109 21 34 1.000
110 21 35 1.000
111 21 36 1.000
112 21 37 1.000
113 21 38 1.000
114 21 103 1.000
115 21 104 1.000
116 21 105 1.000
117 22 23 1.000
118 22 24 1.000
119 22 34 1.000
120 22 35 1.000
121 22 37 1.000
122 22 38 1.000
123 22 101 1.000
124 22 102 1.000
125 22 103 1.000
126 22 104 1.000
127 23 24 1.000
128 23 25 1.000
129 23 31 1.000
130 23 32 1.000
131 23 33 1.000
132 23 34 1.000
133 23 35 1.000
134 23 38 1.000
135 23 101 1.000
136 23 102 1.000
137 23 103 1.000
138 24 25 1.000
139 24 26 1.000
140 24 31 1.000
141 24 32 1.000
142 24 33 1.000
143 24 34 1.000
144 24 99 1.000
145 24 100 1.000
146 24 101 1.000
147 24 102 1.000
148 25 26 1.000
149 25 27 1.000
150 25 28 1.000
151 25 29 1.000
152 25 30 1.000
153 25 31 1.000
154 25 32 1.000
155 25 33 1.000
156 25 99 1.000
157 25 100 1.000
158 25 101 1.000
159 25 102 1.000
160 26 27 1.000
161 26 28 1.000
162 26 29 1.000
163 26 30 1.000
164 26 31 1.000
165 26 32 1.000
166 26 98 1.000
167 26 99 1.000
168 26 100 1.000
169 27 28 1.000
170 27 29 1.000
171 27 30 1.000
172 27 98 1.000
173 27 99 1.000
174 27 100 1.000
175 28 29 1.000
176 28 30 1.000
177 29 30 1.000
178 29 31 1.000
179 29 43 1.000
180 29 46 1.000
181 30 31 1.000
182 30 32 1.000
183 31 32 1.000
184 31 33 1.000
185 31 34 1.000
186 32 33 1.000
187 32 34 1.000
188 33 34 1.000
189 33 35 1.000
190 34 35 1.000
191 34 36 1.000
192 34 38 1.000
193 35 36 1.000
194 35 37 1.000
195 35 38 1.000
196 36 37 1.000
197 36 38 1.000
198 37 38 1.000
199 37 39 1.000
200 38 39 1.000
201 38 40 1.000
202 39 40 1.000
203 39 41 1.000
204 39 66 1.000
205 39 67 1.000
206 40 41 1.000
207 40 42 1.000
208 40 67 1.000
209 41 42 1.000
210 41 43 1.000
211 41 45 1.000
212 41 46 1.000
213 41 66 1.000
214 41 67 1.000
215 41 68 1.000
216 42 43 1.000
217 42 44 1.000
218 42 45 1.000
219 42 46 1.000
220 42 66 1.000
221 42 67 1.000
222 42 68 1.000
223 43 44 1.000
224 43 45 1.000
225 43 46 1.000
226 43 47 1.000
227 44 45 1.000
228 44 46 1.000
229 44 47 1.000
230 44 48 1.000
231 45 46 1.000
232 45 47 1.000
233 45 48 1.000
234 45 49 1.000
235 45 65 1.000
236 45 66 1.000
237 45 67 1.000
238 46 47 1.000
239 46 48 1.000
240 46 49 1.000
241 46 50 1.000
242 47 48 1.000
243 47 49 1.000
244 47 50 1.000
245 47 51 1.000
246 48 49 1.000
247 48 50 1.000
248 48 51 1.000
249 48 52 1.000
250 48 59 1.000
251 49 50 1.000
252 49 51 1.000
253 49 52 1.000
254 49 53 1.000
255 49 59 1.000
256 49 64 1.000
257 50 51 1.000
258 50 52 1.000
259 50 53 1.000
260 50 54 1.000
261 51 52 1.000
262 51 53 1.000
263 51 54 1.000
264 51 55 1.000
265 51 58 1.000
266 52 53 1.000
267 52 54 1.000
268 52 55 1.000
269 52 56 1.000
270 52 57 1.000
271 52 58 1.000
272 52 59 1.000
273 52 79 1.000
274 53 54 1.000
275 53 55 1.000
276 53 56 1.000
277 53 78 1.000
278 53 79 1.000
279 53 80 1.000
280 53 81 1.000
281 53 82 1.000
282 54 55 1.000
283 54 56 1.000
284 54 79 1.000
285 55 56 1.000
286 55 57 1.000
287 55 58 1.000
288 55 79 1.000
289 56 57 1.000
290 56 58 1.000
291 56 78 1.000
292 56 79 1.000
293 57 58 1.000
294 57 59 1.000
295 57 60 1.000
296 57 61 1.000
297 58 59 1.000
298 58 60 1.000
299 58 61 1.000
300 59 60 1.000
301 59 61 1.000
302 59 62 1.000
303 59 63 1.000
304 59 64 1.000
305 59 73 1.000
306 60 61 1.000
307 60 62 1.000
308 60 63 1.000
309 60 64 1.000
310 60 73 1.000
311 60 74 1.000
312 61 62 1.000
313 61 63 1.000
314 62 63 1.000
315 62 64 1.000
316 63 64 1.000
317 63 65 1.000
318 63 70 1.000
319 63 71 1.000
320 63 73 1.000
321 64 65 1.000
322 64 66 1.000
323 64 70 1.000
324 64 71 1.000
325 64 73 1.000
326 64 84 1.000
327 65 66 1.000
328 65 67 1.000
329 65 68 1.000
330 65 69 1.000
331 65 70 1.000
332 65 71 1.000
333 66 67 1.000
334 66 68 1.000
335 66 69 1.000
336 66 70 1.000
337 66 71 1.000
338 67 68 1.000
339 67 69 1.000
340 68 69 1.000
341 68 70 1.000
342 69 70 1.000
343 69 71 1.000
344 70 71 1.000
345 70 86 1.000
346 71 73 1.000
347 71 84 1.000
348 71 85 1.000
349 71 86 1.000
350 71 90 1.000
351 73 74 1.000
352 73 75 1.000
353 73 82 1.000
354 73 83 1.000
355 73 84 1.000
356 73 85 1.000
357 74 75 1.000
358 74 76 1.000
359 74 82 1.000
360 74 83 1.000
361 74 84 1.000
362 74 85 1.000
363 75 76 1.000
364 75 77 1.000
365 75 82 1.000
366 75 83 1.000
367 76 77 1.000
368 76 78 1.000
369 76 80 1.000
370 76 81 1.000
371 76 82 1.000
372 76 83 1.000
373 77 78 1.000
374 77 79 1.000
375 77 80 1.000
376 77 81 1.000
377 77 82 1.000
378 78 79 1.000
379 78 80 1.000
380 78 81 1.000
381 79 80 1.000
382 79 81 1.000
383 79 95 1.000
384 80 81 1.000
385 80 82 1.000
386 80 94 1.000
387 80 95 1.000
388 80 96 1.000
389 81 82 1.000
390 81 83 1.000
391 81 92 1.000
392 81 93 1.000
393 81 94 1.000
394 81 95 1.000
395 81 119 1.000
396 82 83 1.000
397 82 84 1.000
398 82 92 1.000
399 82 93 1.000
400 82 94 1.000
401 83 84 1.000
402 83 85 1.000
403 83 90 1.000
404 83 91 1.000
405 83 92 1.000
406 83 93 1.000
407 84 85 1.000
408 84 86 1.000
409 84 90 1.000
410 84 91 1.000
411 84 92 1.000
412 85 86 1.000
413 85 87 1.000
414 85 88 1.000
415 85 89 1.000
416 85 90 1.000
417 85 91 1.000
418 86 87 1.000
419 86 88 1.000
420 86 89 1.000
421 86 90 1.000
422 87 88 1.000
423 87 89 1.000
424 87 90 1.000
425 88 89 1.000
426 88 90 1.000
427 88 106 1.000
428 88 107 1.000
429 89 90 1.000
430 89 91 1.000
431 89 104 1.000
432 89 105 1.000
433 89 106 1.000
434 89 107 1.000
435 89 110 1.000
436 89 111 1.000
437 90 91 1.000
438 90 92 1.000
439 90 104 1.000
440 90 105 1.000
441 90 106 1.000
442 90 111 1.000
443 91 92 1.000
444 91 93 1.000
445 91 102 1.000
446 91 103 1.000
447 91 104 1.000
448 91 105 1.000
449 91 111 1.000
450 91 114 1.000
451 92 93 1.000
452 92 94 1.000
453 92 102 1.000
454 92 103 1.000
455 92 104 1.000
456 92 111 1.000
457 92 114 1.000
458 92 115 1.000
459 92 118 1.000
460 93 94 1.000
461 93 95 1.000
462 93 100 1.000
463 93 101 1.000
464 93 102 1.000
465 93 103 1.000
466 93 118 1.000
467 94 95 1.000
468 94 96 1.000
469 94 100 1.000
470 94 101 1.000
471 94 102 1.000
472 94 118 1.000
473 94 119 1.000
474 94 122 1.000
475 95 96 1.000
476 95 97 1.000
477 95 98 1.000
478 95 99 1.000
479 95 100 1.000
480 95 101 1.000
481 95 122 1.000
482 96 97 1.000
483 96 98 1.000
484 96 99 1.000
485 96 100 1.000
486 96 101 1.000
487 96 122 1.000
488 96 123 1.000
489 96 125 1.000
490 96 126 1.000
491 96 130 1.000
492 97 98 1.000
493 97 99 1.000
494 97 125 1.000
495 97 126 1.000
496 97 129 1.000
497 97 130 1.000
498 98 99 1.000
499 98 100 1.000
500 98 130 1.000
501 99 100 1.000
502 99 101 1.000
503 99 130 1.000
504 100 101 1.000
505 100 102 1.000
506 101 102 1.000
507 101 103 1.000
508 101 118 1.000
509 101 121 1.000
510 101 122 1.000
511 102 103 1.000
512 102 104 1.000
513 102 118 1.000
514 103 104 1.000
515 103 105 1.000
516 103 114 1.000
517 103 118 1.000
518 104 105 1.000
519 104 106 1.000
520 104 114 1.000
521 105 106 1.000
522 105 107 1.000
523 105 110 1.000
524 105 111 1.000
525 105 114 1.000
526 106 107 1.000
527 106 108 1.000
528 106 110 1.000
529 107 108 1.000
530 107 110 1.000
531 108 110 1.000
532 110 111 1.000
533 110 112 1.000
534 110 113 1.000
535 110 114 1.000
536 111 112 1.000
537 111 113 1.000
538 111 114 1.000
539 111 115 1.000
540 112 113 1.000
541 112 114 1.000
542 112 115 1.000
543 112 116 1.000
544 113 114 1.000
545 113 115 1.000
546 113 116 1.000
547 113 117 1.000
548 114 115 1.000
549 114 116 1.000
550 114 117 1.000
551 114 118 1.000
552 115 116 1.000
553 115 117 1.000
554 115 118 1.000
555 115 119 1.000
556 116 117 1.000
557 116 118 1.000
558 116 119 1.000
559 116 120 1.000
560 117 118 1.000
561 117 119 1.000
562 117 120 1.000
563 117 121 1.000
564 118 119 1.000
565 118 120 1.000
566 118 121 1.000
567 118 122 1.000
568 119 120 1.000
569 119 121 1.000
570 119 122 1.000
571 119 123 1.000
572 120 121 1.000
573 120 122 1.000
574 120 123 1.000
575 120 124 1.000
576 121 122 1.000
577 121 123 1.000
578 121 124 1.000
579 121 125 1.000
580 122 123 1.000
581 122 124 1.000
582 122 125 1.000
583 122 126 1.000
584 123 124 1.000
585 123 125 1.000
586 123 126 1.000
587 123 127 1.000
588 124 125 1.000
589 124 126 1.000
590 124 127 1.000
591 124 128 1.000
592 125 126 1.000
593 125 127 1.000
594 125 128 1.000
595 125 129 1.000
596 125 130 1.000
597 126 127 1.000
598 126 128 1.000
599 126 129 1.000
600 126 130 1.000
601 127 128 1.000
602 127 129 1.000
603 127 130 1.000
604 128 129 1.000
605 128 130 1.000
606 129 130 1.000