ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/3nulA_Cb_8.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 8258 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: SWQSYVDDHLXCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYXVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPXTGGQCNLVVERLGDYLIESEL
3 #PDB: 3nul
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: Cb
8 #CUTOFF: 8.0
9 1 2 1.000
10 1 3 1.000
11 1 4 1.000
12 1 5 1.000
13 1 33 1.000
14 2 3 1.000
15 2 4 1.000
16 2 5 1.000
17 2 6 1.000
18 2 24 1.000
19 2 32 1.000
20 2 33 1.000
21 3 4 1.000
22 3 5 1.000
23 3 6 1.000
24 3 7 1.000
25 3 33 1.000
26 4 5 1.000
27 4 6 1.000
28 4 7 1.000
29 4 8 1.000
30 4 9 1.000
31 5 6 1.000
32 5 7 1.000
33 5 8 1.000
34 5 9 1.000
35 5 10 1.000
36 5 24 1.000
37 5 33 1.000
38 5 121 1.000
39 5 125 1.000
40 6 7 1.000
41 6 8 1.000
42 6 9 1.000
43 6 10 1.000
44 6 22 1.000
45 6 23 1.000
46 6 24 1.000
47 6 33 1.000
48 6 34 1.000
49 6 35 1.000
50 7 8 1.000
51 7 9 1.000
52 7 10 1.000
53 7 35 1.000
54 8 9 1.000
55 8 12 1.000
56 9 10 1.000
57 9 12 1.000
58 9 117 1.000
59 9 120 1.000
60 9 121 1.000
61 9 124 1.000
62 10 12 1.000
63 10 19 1.000
64 10 22 1.000
65 10 24 1.000
66 10 35 1.000
67 10 101 1.000
68 10 103 1.000
69 10 117 1.000
70 10 118 1.000
71 10 121 1.000
72 12 13 1.000
73 12 14 1.000
74 12 18 1.000
75 12 117 1.000
76 13 14 1.000
77 13 15 1.000
78 13 16 1.000
79 13 17 1.000
80 13 18 1.000
81 14 15 1.000
82 14 16 1.000
83 14 17 1.000
84 14 18 1.000
85 14 113 1.000
86 14 116 1.000
87 14 117 1.000
88 15 16 1.000
89 15 17 1.000
90 15 108 1.000
91 15 113 1.000
92 16 17 1.000
93 16 18 1.000
94 17 18 1.000
95 17 105 1.000
96 17 108 1.000
97 17 113 1.000
98 18 19 1.000
99 19 20 1.000
100 19 21 1.000
101 19 22 1.000
102 19 35 1.000
103 19 103 1.000
104 19 104 1.000
105 19 105 1.000
106 19 114 1.000
107 19 117 1.000
108 20 21 1.000
109 20 37 1.000
110 20 104 1.000
111 20 105 1.000
112 20 106 1.000
113 21 22 1.000
114 21 23 1.000
115 21 34 1.000
116 21 35 1.000
117 21 36 1.000
118 21 37 1.000
119 21 38 1.000
120 21 39 1.000
121 21 102 1.000
122 21 103 1.000
123 21 104 1.000
124 22 23 1.000
125 22 24 1.000
126 22 34 1.000
127 22 35 1.000
128 22 38 1.000
129 22 101 1.000
130 22 102 1.000
131 22 103 1.000
132 22 104 1.000
133 22 117 1.000
134 22 118 1.000
135 23 24 1.000
136 23 25 1.000
137 23 31 1.000
138 23 32 1.000
139 23 33 1.000
140 23 34 1.000
141 23 35 1.000
142 23 38 1.000
143 23 101 1.000
144 23 102 1.000
145 23 103 1.000
146 24 25 1.000
147 24 26 1.000
148 24 31 1.000
149 24 32 1.000
150 24 33 1.000
151 24 34 1.000
152 24 99 1.000
153 24 100 1.000
154 24 101 1.000
155 24 102 1.000
156 25 26 1.000
157 25 27 1.000
158 25 28 1.000
159 25 29 1.000
160 25 30 1.000
161 25 31 1.000
162 25 32 1.000
163 25 41 1.000
164 25 46 1.000
165 25 99 1.000
166 25 100 1.000
167 25 102 1.000
168 26 27 1.000
169 26 28 1.000
170 26 29 1.000
171 26 30 1.000
172 26 32 1.000
173 26 98 1.000
174 26 99 1.000
175 26 100 1.000
176 27 28 1.000
177 27 29 1.000
178 27 50 1.000
179 27 95 1.000
180 27 98 1.000
181 27 99 1.000
182 27 100 1.000
183 28 29 1.000
184 28 30 1.000
185 29 30 1.000
186 29 31 1.000
187 29 41 1.000
188 29 43 1.000
189 29 46 1.000
190 29 100 1.000
191 30 31 1.000
192 30 32 1.000
193 31 32 1.000
194 31 33 1.000
195 31 34 1.000
196 31 38 1.000
197 32 33 1.000
198 32 99 1.000
199 33 34 1.000
200 34 35 1.000
201 34 36 1.000
202 34 38 1.000
203 35 36 1.000
204 35 37 1.000
205 35 38 1.000
206 36 37 1.000
207 36 38 1.000
208 37 38 1.000
209 37 39 1.000
210 37 104 1.000
211 38 39 1.000
212 38 102 1.000
213 38 104 1.000
214 39 40 1.000
215 39 41 1.000
216 39 66 1.000
217 39 67 1.000
218 39 69 1.000
219 39 104 1.000
220 40 41 1.000
221 40 42 1.000
222 40 67 1.000
223 41 42 1.000
224 41 43 1.000
225 41 45 1.000
226 41 46 1.000
227 41 66 1.000
228 41 67 1.000
229 42 43 1.000
230 42 44 1.000
231 42 45 1.000
232 42 46 1.000
233 42 65 1.000
234 42 67 1.000
235 42 68 1.000
236 43 44 1.000
237 43 45 1.000
238 43 46 1.000
239 43 47 1.000
240 44 45 1.000
241 44 46 1.000
242 44 47 1.000
243 44 48 1.000
244 45 46 1.000
245 45 47 1.000
246 45 48 1.000
247 45 49 1.000
248 45 65 1.000
249 45 66 1.000
250 45 67 1.000
251 45 68 1.000
252 46 47 1.000
253 46 48 1.000
254 46 49 1.000
255 46 50 1.000
256 46 100 1.000
257 47 48 1.000
258 47 49 1.000
259 47 50 1.000
260 47 51 1.000
261 48 49 1.000
262 48 50 1.000
263 48 51 1.000
264 48 52 1.000
265 48 58 1.000
266 48 59 1.000
267 49 50 1.000
268 49 51 1.000
269 49 52 1.000
270 49 53 1.000
271 49 59 1.000
272 49 64 1.000
273 49 82 1.000
274 49 93 1.000
275 49 100 1.000
276 50 51 1.000
277 50 52 1.000
278 50 53 1.000
279 50 54 1.000
280 51 52 1.000
281 51 53 1.000
282 51 54 1.000
283 51 55 1.000
284 51 58 1.000
285 51 59 1.000
286 52 53 1.000
287 52 54 1.000
288 52 55 1.000
289 52 56 1.000
290 52 57 1.000
291 52 58 1.000
292 52 59 1.000
293 52 64 1.000
294 52 79 1.000
295 52 82 1.000
296 53 54 1.000
297 53 56 1.000
298 53 79 1.000
299 53 80 1.000
300 53 82 1.000
301 53 95 1.000
302 54 55 1.000
303 54 58 1.000
304 54 79 1.000
305 55 56 1.000
306 55 57 1.000
307 55 58 1.000
308 56 57 1.000
309 56 58 1.000
310 56 78 1.000
311 56 79 1.000
312 57 58 1.000
313 57 59 1.000
314 57 60 1.000
315 57 61 1.000
316 57 73 1.000
317 58 59 1.000
318 58 60 1.000
319 59 60 1.000
320 59 61 1.000
321 59 62 1.000
322 59 63 1.000
323 59 64 1.000
324 59 73 1.000
325 59 82 1.000
326 60 61 1.000
327 60 63 1.000
328 60 73 1.000
329 61 62 1.000
330 61 63 1.000
331 62 63 1.000
332 63 64 1.000
333 63 65 1.000
334 63 70 1.000
335 63 71 1.000
336 63 73 1.000
337 64 65 1.000
338 64 66 1.000
339 64 70 1.000
340 64 71 1.000
341 64 73 1.000
342 64 82 1.000
343 64 84 1.000
344 64 91 1.000
345 65 66 1.000
346 65 67 1.000
347 65 68 1.000
348 65 69 1.000
349 65 70 1.000
350 65 71 1.000
351 66 67 1.000
352 66 68 1.000
353 66 69 1.000
354 66 71 1.000
355 66 91 1.000
356 67 68 1.000
357 67 69 1.000
358 68 69 1.000
359 68 70 1.000
360 69 70 1.000
361 69 71 1.000
362 69 86 1.000
363 70 71 1.000
364 70 86 1.000
365 71 73 1.000
366 71 84 1.000
367 71 85 1.000
368 71 86 1.000
369 71 90 1.000
370 71 91 1.000
371 73 74 1.000
372 73 82 1.000
373 73 83 1.000
374 73 84 1.000
375 74 75 1.000
376 74 76 1.000
377 74 83 1.000
378 74 84 1.000
379 74 85 1.000
380 75 76 1.000
381 75 83 1.000
382 76 77 1.000
383 76 78 1.000
384 76 81 1.000
385 76 82 1.000
386 76 83 1.000
387 77 78 1.000
388 77 79 1.000
389 77 80 1.000
390 77 81 1.000
391 78 79 1.000
392 78 80 1.000
393 79 80 1.000
394 79 81 1.000
395 79 95 1.000
396 80 81 1.000
397 80 94 1.000
398 80 95 1.000
399 81 82 1.000
400 81 83 1.000
401 81 92 1.000
402 81 93 1.000
403 81 94 1.000
404 81 95 1.000
405 81 115 1.000
406 81 119 1.000
407 82 83 1.000
408 82 84 1.000
409 82 91 1.000
410 82 92 1.000
411 82 93 1.000
412 83 84 1.000
413 83 85 1.000
414 83 90 1.000
415 83 91 1.000
416 83 92 1.000
417 83 93 1.000
418 83 111 1.000
419 83 115 1.000
420 84 85 1.000
421 84 86 1.000
422 84 90 1.000
423 84 91 1.000
424 84 92 1.000
425 85 86 1.000
426 85 87 1.000
427 85 89 1.000
428 85 90 1.000
429 86 87 1.000
430 86 89 1.000
431 86 90 1.000
432 86 91 1.000
433 87 88 1.000
434 87 89 1.000
435 87 90 1.000
436 88 89 1.000
437 88 106 1.000
438 88 107 1.000
439 89 90 1.000
440 89 91 1.000
441 89 105 1.000
442 89 106 1.000
443 89 107 1.000
444 89 111 1.000
445 90 91 1.000
446 90 92 1.000
447 90 104 1.000
448 90 105 1.000
449 90 106 1.000
450 90 111 1.000
451 90 114 1.000
452 91 92 1.000
453 91 93 1.000
454 91 102 1.000
455 91 103 1.000
456 91 104 1.000
457 91 105 1.000
458 91 114 1.000
459 92 93 1.000
460 92 94 1.000
461 92 101 1.000
462 92 102 1.000
463 92 103 1.000
464 92 111 1.000
465 92 114 1.000
466 92 115 1.000
467 92 118 1.000
468 92 119 1.000
469 93 94 1.000
470 93 95 1.000
471 93 100 1.000
472 93 101 1.000
473 93 102 1.000
474 93 103 1.000
475 93 118 1.000
476 94 95 1.000
477 94 96 1.000
478 94 100 1.000
479 94 101 1.000
480 94 118 1.000
481 94 119 1.000
482 94 121 1.000
483 94 122 1.000
484 95 96 1.000
485 95 100 1.000
486 95 101 1.000
487 96 97 1.000
488 96 98 1.000
489 96 99 1.000
490 96 100 1.000
491 96 101 1.000
492 96 122 1.000
493 96 125 1.000
494 96 126 1.000
495 96 130 1.000
496 97 98 1.000
497 97 99 1.000
498 97 125 1.000
499 97 126 1.000
500 97 129 1.000
501 97 130 1.000
502 98 99 1.000
503 98 130 1.000
504 99 100 1.000
505 99 101 1.000
506 99 125 1.000
507 99 130 1.000
508 100 101 1.000
509 100 102 1.000
510 101 102 1.000
511 101 103 1.000
512 101 118 1.000
513 101 121 1.000
514 101 122 1.000
515 101 125 1.000
516 102 103 1.000
517 102 104 1.000
518 102 118 1.000
519 103 104 1.000
520 103 105 1.000
521 103 114 1.000
522 103 117 1.000
523 103 118 1.000
524 104 105 1.000
525 104 106 1.000
526 104 114 1.000
527 105 106 1.000
528 105 110 1.000
529 105 111 1.000
530 105 113 1.000
531 105 114 1.000
532 106 107 1.000
533 107 108 1.000
534 108 110 1.000
535 110 111 1.000
536 110 112 1.000
537 110 113 1.000
538 110 114 1.000
539 111 112 1.000
540 111 113 1.000
541 111 114 1.000
542 111 115 1.000
543 112 113 1.000
544 112 114 1.000
545 112 115 1.000
546 112 116 1.000
547 113 114 1.000
548 113 115 1.000
549 113 116 1.000
550 113 117 1.000
551 114 115 1.000
552 114 116 1.000
553 114 117 1.000
554 114 118 1.000
555 115 116 1.000
556 115 117 1.000
557 115 118 1.000
558 115 119 1.000
559 116 117 1.000
560 116 118 1.000
561 116 119 1.000
562 116 120 1.000
563 117 118 1.000
564 117 119 1.000
565 117 120 1.000
566 117 121 1.000
567 118 119 1.000
568 118 120 1.000
569 118 121 1.000
570 118 122 1.000
571 119 120 1.000
572 119 121 1.000
573 119 122 1.000
574 119 123 1.000
575 120 121 1.000
576 120 122 1.000
577 120 123 1.000
578 120 124 1.000
579 121 122 1.000
580 121 123 1.000
581 121 124 1.000
582 121 125 1.000
583 122 123 1.000
584 122 124 1.000
585 122 125 1.000
586 122 126 1.000
587 123 124 1.000
588 123 125 1.000
589 123 126 1.000
590 123 127 1.000
591 124 125 1.000
592 124 126 1.000
593 124 127 1.000
594 124 128 1.000
595 125 126 1.000
596 125 127 1.000
597 125 128 1.000
598 125 130 1.000
599 126 127 1.000
600 126 128 1.000
601 126 129 1.000
602 126 130 1.000
603 127 128 1.000
604 127 129 1.000
605 128 129 1.000
606 128 130 1.000
607 129 130 1.000