ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/3nulA_SC_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 9 months ago) by duarte
File size: 3190 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line User Rev File contents
1 duarte 884 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: SWQSYVDDHLXCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYXVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPXTGGQCNLVVERLGDYLIESEL
3     #PDB: 3nul
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: SC
8     #CUTOFF: 5.0
9     1 3 1.000
10     1 4 1.000
11     2 5 1.000
12     2 24 1.000
13     2 32 1.000
14     2 33 1.000
15     2 125 1.000
16     2 130 1.000
17     3 6 1.000
18     3 7 1.000
19     3 33 1.000
20     4 8 1.000
21     4 9 1.000
22     5 9 1.000
23     5 24 1.000
24     5 121 1.000
25     5 124 1.000
26     5 125 1.000
27     5 130 1.000
28     6 7 1.000
29     6 10 1.000
30     6 22 1.000
31     6 24 1.000
32     6 33 1.000
33     6 35 1.000
34     7 8 1.000
35     8 9 1.000
36     9 10 1.000
37     9 121 1.000
38     10 19 1.000
39     10 22 1.000
40     10 24 1.000
41     10 101 1.000
42     10 117 1.000
43     10 118 1.000
44     10 121 1.000
45     12 120 1.000
46     13 18 1.000
47     14 15 1.000
48     14 113 1.000
49     14 117 1.000
50     15 17 1.000
51     15 113 1.000
52     17 108 1.000
53     17 113 1.000
54     19 22 1.000
55     19 105 1.000
56     19 114 1.000
57     19 117 1.000
58     19 118 1.000
59     20 21 1.000
60     20 37 1.000
61     20 104 1.000
62     20 106 1.000
63     21 35 1.000
64     21 37 1.000
65     21 38 1.000
66     21 39 1.000
67     21 104 1.000
68     22 35 1.000
69     23 25 1.000
70     23 34 1.000
71     23 38 1.000
72     23 102 1.000
73     24 32 1.000
74     24 99 1.000
75     24 101 1.000
76     24 121 1.000
77     24 125 1.000
78     25 31 1.000
79     25 38 1.000
80     25 41 1.000
81     25 46 1.000
82     25 100 1.000
83     25 102 1.000
84     27 50 1.000
85     27 95 1.000
86     27 96 1.000
87     27 100 1.000
88     28 30 1.000
89     28 32 1.000
90     30 32 1.000
91     31 34 1.000
92     32 33 1.000
93     32 98 1.000
94     32 99 1.000
95     34 38 1.000
96     35 38 1.000
97     36 37 1.000
98     38 39 1.000
99     38 41 1.000
100     38 102 1.000
101     38 104 1.000
102     39 41 1.000
103     39 104 1.000
104     41 45 1.000
105     41 46 1.000
106     41 66 1.000
107     41 102 1.000
108     41 104 1.000
109     42 43 1.000
110     42 44 1.000
111     42 45 1.000
112     44 45 1.000
113     44 47 1.000
114     45 65 1.000
115     45 66 1.000
116     46 50 1.000
117     46 100 1.000
118     47 50 1.000
119     49 53 1.000
120     49 64 1.000
121     49 66 1.000
122     49 82 1.000
123     49 93 1.000
124     49 100 1.000
125     49 102 1.000
126     50 100 1.000
127     51 55 1.000
128     51 58 1.000
129     52 58 1.000
130     52 59 1.000
131     52 82 1.000
132     53 82 1.000
133     53 93 1.000
134     53 95 1.000
135     53 100 1.000
136     54 55 1.000
137     55 56 1.000
138     55 58 1.000
139     56 78 1.000
140     58 59 1.000
141     59 64 1.000
142     59 73 1.000
143     59 82 1.000
144     60 61 1.000
145     60 73 1.000
146     61 62 1.000
147     64 66 1.000
148     64 71 1.000
149     64 73 1.000
150     64 82 1.000
151     64 91 1.000
152     64 93 1.000
153     65 70 1.000
154     66 71 1.000
155     66 91 1.000
156     66 93 1.000
157     66 102 1.000
158     66 104 1.000
159     69 71 1.000
160     69 86 1.000
161     71 86 1.000
162     71 91 1.000
163     71 104 1.000
164     74 83 1.000
165     74 85 1.000
166     75 83 1.000
167     77 80 1.000
168     77 81 1.000
169     77 94 1.000
170     77 119 1.000
171     80 81 1.000
172     80 94 1.000
173     81 83 1.000
174     81 92 1.000
175     81 94 1.000
176     81 119 1.000
177     82 93 1.000
178     83 92 1.000
179     83 115 1.000
180     83 119 1.000
181     85 105 1.000
182     88 107 1.000
183     91 93 1.000
184     91 104 1.000
185     92 114 1.000
186     92 115 1.000
187     92 118 1.000
188     92 119 1.000
189     93 100 1.000
190     93 102 1.000
191     94 96 1.000
192     94 101 1.000
193     94 118 1.000
194     94 119 1.000
195     94 123 1.000
196     94 126 1.000
197     95 100 1.000
198     96 99 1.000
199     96 101 1.000
200     96 125 1.000
201     96 126 1.000
202     97 98 1.000
203     97 126 1.000
204     98 99 1.000
205     98 130 1.000
206     100 102 1.000
207     101 118 1.000
208     101 121 1.000
209     101 125 1.000
210     102 104 1.000
211     105 114 1.000
212     107 108 1.000
213     110 113 1.000
214     114 115 1.000
215     114 118 1.000
216     115 119 1.000
217     116 120 1.000
218     117 118 1.000
219     117 120 1.000
220     118 119 1.000
221     119 123 1.000
222     120 121 1.000
223     121 124 1.000
224     121 125 1.000
225     123 126 1.000
226     124 125 1.000
227     124 128 1.000
228     125 130 1.000
229     128 130 1.000