ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/tests/proteinstructure/data/3nulA_SC_5.0.cm
Revision: 884
Committed: Tue Aug 11 16:01:00 2009 UTC (10 years, 2 months ago) by duarte
File size: 3190 byte(s)
Log Message:
Major commit: 
- change of the implementation of Pdb (interface remains backwards compatible). Now data stored in a proper object-oriented way. Pdb not abstract anymore, a protein model can be created by using one of the constructors
- added many tests and test files for Pdb (and merged some already existing tests from the default package)
- removed obsolete classes related to msd
- bug fix: PdbfilePdb now properly reads files with alt codes
- all tests passed
Line File contents
1 #CMVIEW GRAPH FILE ver: 1.0
2 #SEQUENCE: SWQSYVDDHLXCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLAPTGLFLGGEKYXVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPXTGGQCNLVVERLGDYLIESEL
3 #PDB: 3nul
4 #PDB CHAIN CODE: A
5 #CHAIN: A
6 #MODEL: 1
7 #CT: SC
8 #CUTOFF: 5.0
9 1 3 1.000
10 1 4 1.000
11 2 5 1.000
12 2 24 1.000
13 2 32 1.000
14 2 33 1.000
15 2 125 1.000
16 2 130 1.000
17 3 6 1.000
18 3 7 1.000
19 3 33 1.000
20 4 8 1.000
21 4 9 1.000
22 5 9 1.000
23 5 24 1.000
24 5 121 1.000
25 5 124 1.000
26 5 125 1.000
27 5 130 1.000
28 6 7 1.000
29 6 10 1.000
30 6 22 1.000
31 6 24 1.000
32 6 33 1.000
33 6 35 1.000
34 7 8 1.000
35 8 9 1.000
36 9 10 1.000
37 9 121 1.000
38 10 19 1.000
39 10 22 1.000
40 10 24 1.000
41 10 101 1.000
42 10 117 1.000
43 10 118 1.000
44 10 121 1.000
45 12 120 1.000
46 13 18 1.000
47 14 15 1.000
48 14 113 1.000
49 14 117 1.000
50 15 17 1.000
51 15 113 1.000
52 17 108 1.000
53 17 113 1.000
54 19 22 1.000
55 19 105 1.000
56 19 114 1.000
57 19 117 1.000
58 19 118 1.000
59 20 21 1.000
60 20 37 1.000
61 20 104 1.000
62 20 106 1.000
63 21 35 1.000
64 21 37 1.000
65 21 38 1.000
66 21 39 1.000
67 21 104 1.000
68 22 35 1.000
69 23 25 1.000
70 23 34 1.000
71 23 38 1.000
72 23 102 1.000
73 24 32 1.000
74 24 99 1.000
75 24 101 1.000
76 24 121 1.000
77 24 125 1.000
78 25 31 1.000
79 25 38 1.000
80 25 41 1.000
81 25 46 1.000
82 25 100 1.000
83 25 102 1.000
84 27 50 1.000
85 27 95 1.000
86 27 96 1.000
87 27 100 1.000
88 28 30 1.000
89 28 32 1.000
90 30 32 1.000
91 31 34 1.000
92 32 33 1.000
93 32 98 1.000
94 32 99 1.000
95 34 38 1.000
96 35 38 1.000
97 36 37 1.000
98 38 39 1.000
99 38 41 1.000
100 38 102 1.000
101 38 104 1.000
102 39 41 1.000
103 39 104 1.000
104 41 45 1.000
105 41 46 1.000
106 41 66 1.000
107 41 102 1.000
108 41 104 1.000
109 42 43 1.000
110 42 44 1.000
111 42 45 1.000
112 44 45 1.000
113 44 47 1.000
114 45 65 1.000
115 45 66 1.000
116 46 50 1.000
117 46 100 1.000
118 47 50 1.000
119 49 53 1.000
120 49 64 1.000
121 49 66 1.000
122 49 82 1.000
123 49 93 1.000
124 49 100 1.000
125 49 102 1.000
126 50 100 1.000
127 51 55 1.000
128 51 58 1.000
129 52 58 1.000
130 52 59 1.000
131 52 82 1.000
132 53 82 1.000
133 53 93 1.000
134 53 95 1.000
135 53 100 1.000
136 54 55 1.000
137 55 56 1.000
138 55 58 1.000
139 56 78 1.000
140 58 59 1.000
141 59 64 1.000
142 59 73 1.000
143 59 82 1.000
144 60 61 1.000
145 60 73 1.000
146 61 62 1.000
147 64 66 1.000
148 64 71 1.000
149 64 73 1.000
150 64 82 1.000
151 64 91 1.000
152 64 93 1.000
153 65 70 1.000
154 66 71 1.000
155 66 91 1.000
156 66 93 1.000
157 66 102 1.000
158 66 104 1.000
159 69 71 1.000
160 69 86 1.000
161 71 86 1.000
162 71 91 1.000
163 71 104 1.000
164 74 83 1.000
165 74 85 1.000
166 75 83 1.000
167 77 80 1.000
168 77 81 1.000
169 77 94 1.000
170 77 119 1.000
171 80 81 1.000
172 80 94 1.000
173 81 83 1.000
174 81 92 1.000
175 81 94 1.000
176 81 119 1.000
177 82 93 1.000
178 83 92 1.000
179 83 115 1.000
180 83 119 1.000
181 85 105 1.000
182 88 107 1.000
183 91 93 1.000
184 91 104 1.000
185 92 114 1.000
186 92 115 1.000
187 92 118 1.000
188 92 119 1.000
189 93 100 1.000
190 93 102 1.000
191 94 96 1.000
192 94 101 1.000
193 94 118 1.000
194 94 119 1.000
195 94 123 1.000
196 94 126 1.000
197 95 100 1.000
198 96 99 1.000
199 96 101 1.000
200 96 125 1.000
201 96 126 1.000
202 97 98 1.000
203 97 126 1.000
204 98 99 1.000
205 98 130 1.000
206 100 102 1.000
207 101 118 1.000
208 101 121 1.000
209 101 125 1.000
210 102 104 1.000
211 105 114 1.000
212 107 108 1.000
213 110 113 1.000
214 114 115 1.000
215 114 118 1.000
216 115 119 1.000
217 116 120 1.000
218 117 118 1.000
219 117 120 1.000
220 118 119 1.000
221 119 123 1.000
222 120 121 1.000
223 121 124 1.000
224 121 125 1.000
225 123 126 1.000
226 124 125 1.000
227 124 128 1.000
228 125 130 1.000
229 128 130 1.000