Bioinformatics.org
[NEU MS in Bioinformatics]
Not logged in
  • Log in
  • Bioinformatics.org
    Membership (37367+) Group hosting [?]
  • Wiki
  • Franklin Award
  • Sponsorships
  • Careers
    About bioinformatics
    Bioinformatics training
    Bioinformatics jobs

    Research
    All information groups
    Online databases Online analysis tools Online education tools More tools

    Development
    All software groups
    FTP repository
    SVN & CVS repositories [?]
    Mailing lists

    Forums
    News & Commentary
  • Submit
  • Archives
  • Subscribe

  • Jobs Forum
    (Career Center)
  • Submit
  • Archives
  • Subscribe
  • News & Commentary - Message forums

    protein function prediction steps
    Submitted by K.Alagarsamy; posted on Tuesday, May 18, 2004 (7 comments)

    Project Introduction:
    Protein is a molecule which is composed of aminoacids(more than 10000)
    Protein has primary ,secondary,Tertiery,Quartery structure.
    Swiss prot or Expasy is primary sequence dbs.it has morethan 2,50000 organism primary sequence.this sequences are auto Annotated.

    AIM:
    1. To predict the function of unknown protein sequence using available data. This prediction based on computational tools and available bioinformatics tools.
    2. This project may include creating new tools & softwares.
    3. Another phase of work is model the unknown protein sequence and predict the 3-D structure of proteins.
    Primary steps involved for finding the protein function.
    1. TO select the unknown protein sequence from swiss (http://www.Expasy.org)
    2. To find the homologous sequence and predict the function based sores with help of BLAST,FASTA,MULTIPLE SEQUENCE ALIGNMENT.
    3. To predict the secodary structure of protein sequence.
    4. To find the TRANSMEMBRANE REGION OF SEQUENCE,COIL REGION.
    5. To assign particular functions and give proper proof of that function(important)
    6. Remember that protein primary sequence related to structure & function.

    Expanded view | Monitor forum | Save place

    Message
    v1
    Submitted by Nobody; posted on Friday, June 03, 2005
    VHWSYVHDGKAKKAKEVVEAVDPDKNLVTFRVIEGDLMEEYKSFVITIQVSPKSEGSGSVVHWTLEYEKLHGGIAHPETLLQFVQDISKDIDAHLTQAS



    Post a followup to this message:
    You have to be logged in to post a reply.
    Thread view
    v1
    Submitted by Nobody; posted on Friday, June 03, 2005
    VHWSYVHDGKAKKAKEVVEAVDPDKNLVTFRVIEGDLMEEYKSFVITIQVSPKSEGSGSVVHWTLEYEKLHGGIAHPETLLQFVQDISKDIDAHLTQAS

     

    Copyright © 2016 · Scilico, LLC