MDT

MGDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVP
ILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNE
TTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSL
KNFPLLKAHNEFISNLPNIKNYITNRKESVY

• The antimalarial Artemisinin is not metabolized by PfGST. PfGST is present as a tetramer in solution, but dissociates into dimers in the presence of GSH [PubMed - 16385005]

• Kavishe RA, Koenderink JB, McCall MB, Peters WH, Mulder B, Hermsen CC, Sauerwein RW, Russel FG, Van der Ven AJ.  Short report: Severe Plasmodium falciparum malaria in Cameroon: associated with the glutathione S-transferase M1 null genotype.  Am J Trop Med Hyg. 2006 Nov;75(5):827-9.  [PubMed - 17123972]

• Hiller N, Fritz-Wolf K, Deponte M, Wende W, Zimmermann H, Becker K. Plasmodium falciparum glutathione S-transferase--structural and mechanistic studies on ligand binding and enzyme inhibition. Protein Sci. 2006 Feb;15(2):281-9. Epub 2005 Dec 29.  [PubMed - 16385005]

• Liebau E, De Maria F, Burmeister C, Perbandt M, Turella P, Antonini G, Federici G, Giansanti F, Stella L, Lo Bello M, Caccuri AM, Ricci G.  Cooperativity and pseudo-cooperativity in the glutathione S-transferase from Plasmodium falciparum. J Biol Chem. 2005 Jul 15;280(28):26121-8. Epub 2005 May 11.  [PubMed - 15888443]

• Fritz-Wolf K, Becker A, Rahlfs S, Harwaldt P, Schirmer RH, Kabsch W, Becker K.  X-ray structure of glutathione S-transferase from the malarial parasite Plasmodium falciparum. Proc Natl Acad Sci U S A. 2003 Nov 25;100(24):13821-6. Epub 2003 Nov 17.  [PubMed - 14623980]

• Perbandt M, Burmeister C, Walter RD, Betzel C, Liebau E.  Native and inhibited structure of a Mu class-related glutathione S-transferase from Plasmodium falciparum. J Biol Chem. 2004 Jan 9;279(2):1336-42. Epub 2003 Sep 12.  [PubMed - 12972411]

• Burmeister C, Perbandt M, Betzel Ch, Walter RD, Liebau E. Crystallization and preliminary X-ray diffraction studies of the glutathione S-transferase from Plasmodium falciparum. Acta Crystallogr D Biol Crystallogr. 2003 Aug;59(Pt 8):1469-71. Epub 2003 Jul 23.  [PubMed - 12876354]

• Liebau E, Bergmann B, Campbell AM, Teesdale-Spittle P, Brophy PM, Luersen K, Walter RD.  The glutathione S-transferase from Plasmodium falciparum. Mol Biochem Parasitol. 2002 Sep-Oct;124(1-2):85-90. No abstract available.  [PubMed - 12387854]

• Harwaldt P, Rahlfs S, Becker K. Glutathione S-transferase of the malarial parasite Plasmodium falciparum: characterization of a potential drug target. Biol Chem. 2002 May;383(5):821-30.  [PubMed - 12108547]