<div>Dear Nagesh</div>  <div>&nbsp;</div>  <div>You can do it again as well as use the other sequences to check this problemb.</div>  <div>&nbsp;</div>  <div>Good luck,</div>  <div>&nbsp;</div>  <div><BR><B><I>Nagesh Chakka &lt;nagesh.chakka@anu.edu.au&gt;</I></B> wrote:</div>  <BLOCKQUOTE class=replbq style="PADDING-LEFT: 5px; MARGIN-LEFT: 5px; BORDER-LEFT: #1010ff 2px solid">Hi,<BR>I am trying to use Modeller to obtain a model using the structure 1XU0.<BR>I have created the three files needed for Modeller<BR><BR>Atom file<BR>http://www.rcsb.org/pdb/navbarsearch.do?newSearch=yes&amp;isAuthorSearch=no&amp;radioset=All&amp;inputQuickSearch=1xu0&amp;image.x=0&amp;image.y=0&amp;image=Search<BR><BR>Alignment
 file<BR><BR>&gt;P1;1XU0<BR>structureX:1XU0:125:A:226:A::::<BR>IGGYMLGNAVGRMSYQFNNPMESRYYNDYYNQMPNRVYRPMYRGEEYVSEDRFVRDCYNM<BR>SVTEYIIKPAEGKNNSELNQLDTTVKSQIIREMCITEYRRGS<BR>*<BR>&gt;P1;XlPrP2<BR>sequence:XlPrP2:1::134:::::<BR>IGGYMLGNAVGRMNHHFDNPMESRYYNDYYNQMPDRVYRPMYRSEEYVSEDRFVTDCYNM<BR>SVTEYIIKPSEGKNGSDVNQLDTVVKSKIIREMCITEYRRGS<BR><BR>Top file<BR><BR>INCLUDE<BR><BR>SET OUTPUT_CONTROL = 1 1 1 1 1<BR>SET ALNFILE = 'inputAlignment_files/prp2StructAli.txt'<BR>SET KNOWNS = '1XU0'<BR>SET SEQUENCE = 'XlPrP2'<BR>SET ATOM_FILES_DIRECTORY = '/home/nagesh/modelling/structure'<BR>SET STARTING_MODEL = 1<BR>SET ENDING_MODEL = 4<BR><BR>CALL ROUTINE = 'model'<BR><BR>In doing so, the final model XlPrP2.B99990004 does not contain all the<BR>atoms for a particular residue.<BR><BR>For example, the following is the part of the model for one amino acid<BR><BR>ATOM 1 N ILE 1 14.910 4.779 7.839 1.00 41.08 <BR>1SG 2<BR>ATOM 2 CA ILE 1 13.848 4.061 8.581 1.00 41.08 <BR>1SG 3<BR>ATOM 3 CB ILE 1 12.9
 18 3.371
 7.630 1.00 41.08 <BR>1SG 4<BR>ATOM 4 CG2 ILE 1 11.924 2.529 8.447 1.00 41.08 <BR>1SG 5<BR>ATOM 5 CG1 ILE 1 12.242 4.416 6.730 1.00 41.08 <BR>1SG 6<BR>ATOM 6 CD1 ILE 1 11.473 3.813 5.557 1.00 41.08 <BR>1SG 7<BR>ATOM 7 C ILE 1 14.422 3.050 9.510 1.00 41.08 <BR>1SG 8<BR>ATOM 8 O ILE 1 15.261 2.235 9.128 1.00 41.08 <BR>1SG 9<BR><BR>Atoms from the structure file<BR><BR>ATOM 1 N ILE A 125 15.197 -5.772 -0.208 1.00 0.00 <BR>N<BR>ATOM 2 CA ILE A 125 14.432 -5.479 0.993 1.00 0.00 <BR>C<BR>ATOM 3 C ILE A 125 14.890 -6.453 2.086 1.00 0.00 <BR>C<BR>ATOM 4 O ILE A 125 14.874 -7.667 1.884 1.00 0.00 <BR>O<BR>ATOM 5 CB ILE A 125 12.922 -5.586 0.661 1.00 0.00 <BR>C<BR>ATOM 6 CG1 ILE A 125 12.526 -4.523 -0.390 1.00 0.00 <BR>C<BR>ATOM 7 CG2 ILE A 125 12.073 -5.416 1.930 1.00 0.00 <BR>C<BR>ATOM 8 CD1 ILE A 125 11.131 -4.703 -1.000 1.00 0.00 <BR>C<BR>ATOM 9 H ILE A 125 14.783 -6.386 -0.892 1.00 0.00 <BR>H<BR>ATOM 10 HA ILE A 125 14.656 -4.459 1.305 1.00 0.00 <BR>H<BR>ATOM 11 HB ILE A 125 12.723 
 -6.575
 0.246 1.00 0.00 <BR>H<BR>ATOM 12 1HG1 ILE A 125 12.591 -3.543 0.075 1.00 0.00 <BR>H<BR>ATOM 13 2HG1 ILE A 125 13.228 -4.540 -1.223 1.00 0.00 <BR>H<BR>ATOM 14 1HG2 ILE A 125 12.338 -4.494 2.447 1.00 0.00 <BR>H<BR>ATOM 15 2HG2 ILE A 125 11.014 -5.400 1.691 1.00 0.00 <BR>H<BR>ATOM 16 3HG2 ILE A 125 12.237 -6.268 2.586 1.00 0.00 <BR>H<BR>ATOM 17 1HD1 ILE A 125 10.989 -3.972 -1.797 1.00 0.00 <BR>H<BR>ATOM 18 2HD1 ILE A 125 11.032 -5.707 -1.414 1.00 0.00 <BR>H<BR>ATOM 19 3HD1 ILE A 125 10.362 -4.542 -0.250 1.00 0.00 <BR>H<BR><BR>What is the reason for the loss of the atoms and how can I fix this.<BR>Thank you very much in advance<BR>Nagesh<BR><BR><BR>_______________________________________________<BR>Bioinformatics.Org general forum - BiO_Bulletin_Board@bioinformatics.org<BR>https://bioinformatics.org/mailman/listinfo/bio_bulletin_board<BR></BLOCKQUOTE><BR><BR><BR>Nguyen Xuan Hung<br> <br>Institute of Biologycal and Food Technology<br>HaNoi University of Technology<br>No.1 Dai Co
 Viet<br>VietNam<p>
                <hr size=1>Relax. Yahoo! Mail 
<a href="http://us.rd.yahoo.com/mail_us/taglines/virusall/*http://communications.yahoo.com/features.php?page=221">virus scanning</a> helps detect nasty viruses!