NetTurnP

From Bioinformatics.Org Wiki

Revision as of 08:38, 12 June 2011 by 220.249.99.129 (Talk)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search

>tr|Q10S27|Q10S27_ORYSJ Eukaryotic porin family protein, expressed OS=Oryza sativa subsp. japonica GN=Os03g0137500 PE=2 SV=1 MSKGPAPFLNIGKRAKDLLYKDYNFDQKFSLTTTSNSGLGLTATGVKIDELFIGDIQTQH KSGKTTVDVKIDSESRVSTTVTVDEALTGLKTSFSFRVPDQKSGKLDLQYLHDHFALNST IGLTSTPLIELAATIGTNELSAGAEVGFDSTSASVTKYNSGICYNKHDFSAAVLLADKGE TLKASYIHTFNETNGATVAAEVTHKLKTKENYFTIGSSHAIDSSTLLKTRFSNGGKVGVL CQHEWRPKSTVSISAEYDPKVVSSPSRFGVAIALKP

Personal tools
Namespaces
Variants
Actions
wiki navigation
Toolbox