ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/src/owl/tests/core/structure/data/1od3A_ALL_5.0.cm
Revision: 1008
Committed: Wed Mar 31 14:03:27 2010 UTC (12 years, 3 months ago) by hstehr
File size: 9922 byte(s)
Log Message:
refactoring: adapting test packages to match new package structure
Line User Rev File contents
1 duarte 884 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: MGSSHHHHHHSSGLVPRGSHMASTPANVNSGPTSPVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSKSGT
3     #PDB: 1od3
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: ALL
8     #CUTOFF: 5.0
9     36 37 1.000
10     36 38 1.000
11     37 38 1.000
12     37 39 1.000
13     38 39 1.000
14     38 40 1.000
15     39 40 1.000
16     39 41 1.000
17     39 84 1.000
18     39 85 1.000
19     39 86 1.000
20     39 145 1.000
21     40 41 1.000
22     40 42 1.000
23     40 46 1.000
24     40 50 1.000
25     40 52 1.000
26     40 82 1.000
27     40 83 1.000
28     40 84 1.000
29     40 85 1.000
30     40 86 1.000
31     41 42 1.000
32     41 43 1.000
33     41 44 1.000
34     41 46 1.000
35     41 85 1.000
36     41 86 1.000
37     42 43 1.000
38     42 44 1.000
39     42 46 1.000
40     42 85 1.000
41     42 86 1.000
42     42 87 1.000
43     42 162 1.000
44     42 163 1.000
45     43 44 1.000
46     43 45 1.000
47     43 86 1.000
48     43 87 1.000
49     43 88 1.000
50     43 90 1.000
51     43 91 1.000
52     43 162 1.000
53     43 163 1.000
54     43 164 1.000
55     43 165 1.000
56     44 45 1.000
57     44 46 1.000
58     44 161 1.000
59     44 162 1.000
60     45 46 1.000
61     45 47 1.000
62     45 160 1.000
63     45 161 1.000
64     45 162 1.000
65     46 47 1.000
66     46 48 1.000
67     46 82 1.000
68     46 85 1.000
69     46 159 1.000
70     46 160 1.000
71     46 161 1.000
72     46 162 1.000
73     46 163 1.000
74     47 48 1.000
75     47 49 1.000
76     47 50 1.000
77     47 51 1.000
78     47 69 1.000
79     47 82 1.000
80     47 159 1.000
81     47 160 1.000
82     47 161 1.000
83     48 49 1.000
84     48 50 1.000
85     48 51 1.000
86     48 71 1.000
87     48 80 1.000
88     48 82 1.000
89     48 158 1.000
90     48 159 1.000
91     48 160 1.000
92     48 161 1.000
93     49 50 1.000
94     49 51 1.000
95     49 61 1.000
96     49 69 1.000
97     49 70 1.000
98     49 71 1.000
99     49 82 1.000
100     49 159 1.000
101     50 51 1.000
102     50 52 1.000
103     50 82 1.000
104     51 52 1.000
105     51 53 1.000
106     51 54 1.000
107     51 59 1.000
108     51 61 1.000
109     51 71 1.000
110     51 80 1.000
111     51 81 1.000
112     51 82 1.000
113     52 53 1.000
114     52 54 1.000
115     52 81 1.000
116     52 82 1.000
117     52 83 1.000
118     53 54 1.000
119     53 55 1.000
120     53 79 1.000
121     53 80 1.000
122     53 81 1.000
123     54 55 1.000
124     54 56 1.000
125     54 79 1.000
126     54 80 1.000
127     54 81 1.000
128     55 56 1.000
129     55 57 1.000
130     55 59 1.000
131     55 77 1.000
132     55 78 1.000
133     55 79 1.000
134     55 80 1.000
135     56 57 1.000
136     56 58 1.000
137     56 59 1.000
138     56 78 1.000
139     56 79 1.000
140     57 58 1.000
141     57 59 1.000
142     57 78 1.000
143     58 59 1.000
144     58 60 1.000
145     58 72 1.000
146     58 73 1.000
147     58 75 1.000
148     58 78 1.000
149     59 60 1.000
150     59 61 1.000
151     59 71 1.000
152     59 72 1.000
153     59 73 1.000
154     59 74 1.000
155     59 78 1.000
156     59 79 1.000
157     59 80 1.000
158     60 61 1.000
159     60 62 1.000
160     60 70 1.000
161     60 71 1.000
162     60 72 1.000
163     60 73 1.000
164     61 62 1.000
165     61 63 1.000
166     61 69 1.000
167     61 70 1.000
168     61 71 1.000
169     62 63 1.000
170     62 64 1.000
171     62 68 1.000
172     62 69 1.000
173     62 70 1.000
174     62 71 1.000
175     62 72 1.000
176     62 73 1.000
177     62 132 1.000
178     62 157 1.000
179     63 64 1.000
180     63 65 1.000
181     63 68 1.000
182     63 69 1.000
183     64 65 1.000
184     64 66 1.000
185     64 67 1.000
186     64 68 1.000
187     64 69 1.000
188     64 70 1.000
189     64 132 1.000
190     64 159 1.000
191     65 66 1.000
192     65 67 1.000
193     66 67 1.000
194     66 68 1.000
195     67 68 1.000
196     67 69 1.000
197     68 69 1.000
198     68 70 1.000
199     69 70 1.000
200     69 71 1.000
201     69 158 1.000
202     69 159 1.000
203     70 71 1.000
204     70 72 1.000
205     70 132 1.000
206     70 157 1.000
207     70 158 1.000
208     70 159 1.000
209     71 72 1.000
210     71 73 1.000
211     71 74 1.000
212     71 80 1.000
213     71 82 1.000
214     71 152 1.000
215     71 156 1.000
216     71 157 1.000
217     71 158 1.000
218     72 73 1.000
219     72 74 1.000
220     72 156 1.000
221     72 157 1.000
222     73 74 1.000
223     73 75 1.000
224     73 78 1.000
225     73 156 1.000
226     73 157 1.000
227     74 75 1.000
228     74 76 1.000
229     74 78 1.000
230     74 152 1.000
231     74 154 1.000
232     74 155 1.000
233     74 156 1.000
234     74 158 1.000
235     75 76 1.000
236     75 77 1.000
237     75 78 1.000
238     75 152 1.000
239     75 153 1.000
240     75 154 1.000
241     75 155 1.000
242     76 77 1.000
243     76 78 1.000
244     76 152 1.000
245     76 153 1.000
246     76 154 1.000
247     77 78 1.000
248     77 79 1.000
249     77 151 1.000
250     77 152 1.000
251     77 153 1.000
252     78 79 1.000
253     78 80 1.000
254     78 150 1.000
255     78 151 1.000
256     78 152 1.000
257     79 80 1.000
258     79 81 1.000
259     79 113 1.000
260     79 149 1.000
261     79 150 1.000
262     79 151 1.000
263     79 152 1.000
264     80 81 1.000
265     80 82 1.000
266     80 148 1.000
267     80 149 1.000
268     80 150 1.000
269     80 152 1.000
270     81 82 1.000
271     81 83 1.000
272     81 111 1.000
273     81 113 1.000
274     81 147 1.000
275     81 148 1.000
276     81 149 1.000
277     82 83 1.000
278     82 84 1.000
279     82 85 1.000
280     82 146 1.000
281     82 147 1.000
282     82 148 1.000
283     82 149 1.000
284     82 150 1.000
285     82 161 1.000
286     83 84 1.000
287     83 85 1.000
288     83 146 1.000
289     83 147 1.000
290     84 85 1.000
291     84 86 1.000
292     84 145 1.000
293     84 146 1.000
294     84 147 1.000
295     85 86 1.000
296     85 87 1.000
297     85 144 1.000
298     85 145 1.000
299     85 146 1.000
300     85 147 1.000
301     85 148 1.000
302     85 163 1.000
303     86 87 1.000
304     86 88 1.000
305     86 144 1.000
306     86 145 1.000
307     87 88 1.000
308     87 89 1.000
309     87 90 1.000
310     87 91 1.000
311     87 139 1.000
312     87 142 1.000
313     87 143 1.000
314     87 144 1.000
315     87 145 1.000
316     87 146 1.000
317     87 148 1.000
318     87 163 1.000
319     88 89 1.000
320     88 90 1.000
321     88 143 1.000
322     88 144 1.000
323     89 90 1.000
324     89 91 1.000
325     89 141 1.000
326     89 142 1.000
327     89 143 1.000
328     89 144 1.000
329     89 165 1.000
330     90 91 1.000
331     90 92 1.000
332     90 141 1.000
333     90 142 1.000
334     90 143 1.000
335     90 165 1.000
336     91 92 1.000
337     91 93 1.000
338     91 139 1.000
339     91 140 1.000
340     91 141 1.000
341     91 142 1.000
342     91 163 1.000
343     91 164 1.000
344     91 165 1.000
345     92 93 1.000
346     92 94 1.000
347     92 137 1.000
348     92 138 1.000
349     92 139 1.000
350     92 140 1.000
351     92 141 1.000
352     92 164 1.000
353     92 165 1.000
354     92 166 1.000
355     93 94 1.000
356     93 95 1.000
357     93 136 1.000
358     93 137 1.000
359     93 138 1.000
360     93 139 1.000
361     93 162 1.000
362     93 163 1.000
363     93 164 1.000
364     93 165 1.000
365     93 166 1.000
366     94 95 1.000
367     94 96 1.000
368     94 108 1.000
369     94 121 1.000
370     94 135 1.000
371     94 136 1.000
372     94 137 1.000
373     94 139 1.000
374     94 161 1.000
375     94 162 1.000
376     94 163 1.000
377     94 164 1.000
378     95 96 1.000
379     95 97 1.000
380     95 134 1.000
381     95 135 1.000
382     95 136 1.000
383     95 160 1.000
384     95 161 1.000
385     95 162 1.000
386     96 97 1.000
387     96 98 1.000
388     96 121 1.000
389     96 133 1.000
390     96 134 1.000
391     96 135 1.000
392     96 158 1.000
393     96 160 1.000
394     96 161 1.000
395     97 98 1.000
396     97 99 1.000
397     97 132 1.000
398     97 133 1.000
399     97 134 1.000
400     97 157 1.000
401     97 158 1.000
402     97 159 1.000
403     97 160 1.000
404     97 161 1.000
405     98 99 1.000
406     98 100 1.000
407     98 106 1.000
408     98 123 1.000
409     98 126 1.000
410     98 131 1.000
411     98 132 1.000
412     98 133 1.000
413     98 135 1.000
414     98 156 1.000
415     98 157 1.000
416     98 158 1.000
417     98 159 1.000
418     99 100 1.000
419     99 101 1.000
420     99 126 1.000
421     99 128 1.000
422     99 129 1.000
423     99 130 1.000
424     99 131 1.000
425     99 132 1.000
426     99 156 1.000
427     99 157 1.000
428     100 101 1.000
429     100 102 1.000
430     100 104 1.000
431     100 123 1.000
432     100 124 1.000
433     100 125 1.000
434     100 126 1.000
435     100 127 1.000
436     100 128 1.000
437     100 129 1.000
438     100 131 1.000
439     100 155 1.000
440     100 156 1.000
441     101 102 1.000
442     101 103 1.000
443     101 125 1.000
444     101 126 1.000
445     101 127 1.000
446     101 128 1.000
447     101 129 1.000
448     102 103 1.000
449     102 104 1.000
450     102 123 1.000
451     102 124 1.000
452     102 125 1.000
453     102 155 1.000
454     103 104 1.000
455     103 105 1.000
456     103 123 1.000
457     103 124 1.000
458     103 125 1.000
459     104 105 1.000
460     104 106 1.000
461     104 121 1.000
462     104 122 1.000
463     104 123 1.000
464     104 124 1.000
465     104 153 1.000
466     104 154 1.000
467     104 155 1.000
468     104 156 1.000
469     105 106 1.000
470     105 107 1.000
471     105 120 1.000
472     105 121 1.000
473     105 122 1.000
474     105 123 1.000
475     105 151 1.000
476     105 152 1.000
477     105 153 1.000
478     105 154 1.000
479     106 107 1.000
480     106 108 1.000
481     106 119 1.000
482     106 120 1.000
483     106 121 1.000
484     106 123 1.000
485     106 150 1.000
486     106 151 1.000
487     106 152 1.000
488     106 156 1.000
489     106 158 1.000
490     107 108 1.000
491     107 109 1.000
492     107 117 1.000
493     107 119 1.000
494     107 120 1.000
495     107 121 1.000
496     107 149 1.000
497     107 150 1.000
498     107 151 1.000
499     108 109 1.000
500     108 110 1.000
501     108 116 1.000
502     108 117 1.000
503     108 118 1.000
504     108 119 1.000
505     108 120 1.000
506     108 121 1.000
507     108 139 1.000
508     108 148 1.000
509     108 149 1.000
510     108 150 1.000
511     108 163 1.000
512     109 110 1.000
513     109 111 1.000
514     109 112 1.000
515     109 113 1.000
516     109 114 1.000
517     109 115 1.000
518     109 116 1.000
519     109 117 1.000
520     109 118 1.000
521     109 147 1.000
522     109 148 1.000
523     109 149 1.000
524     109 151 1.000
525     110 111 1.000
526     110 112 1.000
527     110 115 1.000
528     110 116 1.000
529     110 118 1.000
530     110 146 1.000
531     110 147 1.000
532     110 148 1.000
533     110 149 1.000
534     111 112 1.000
535     111 113 1.000
536     111 147 1.000
537     111 148 1.000
538     111 149 1.000
539     112 113 1.000
540     112 114 1.000
541     112 115 1.000
542     112 149 1.000
543     113 114 1.000
544     113 115 1.000
545     113 149 1.000
546     113 151 1.000
547     114 115 1.000
548     114 116 1.000
549     115 116 1.000
550     115 117 1.000
551     116 117 1.000
552     116 118 1.000
553     117 118 1.000
554     117 119 1.000
555     117 120 1.000
556     117 140 1.000
557     118 119 1.000
558     118 120 1.000
559     118 138 1.000
560     118 139 1.000
561     118 140 1.000
562     118 142 1.000
563     118 148 1.000
564     119 120 1.000
565     119 121 1.000
566     119 138 1.000
567     119 139 1.000
568     120 121 1.000
569     120 122 1.000
570     120 137 1.000
571     120 138 1.000
572     121 122 1.000
573     121 123 1.000
574     121 135 1.000
575     121 136 1.000
576     121 137 1.000
577     122 123 1.000
578     122 124 1.000
579     122 135 1.000
580     123 124 1.000
581     123 125 1.000
582     123 135 1.000
583     123 156 1.000
584     124 125 1.000
585     124 126 1.000
586     125 126 1.000
587     125 127 1.000
588     125 128 1.000
589     126 127 1.000
590     126 128 1.000
591     126 129 1.000
592     126 131 1.000
593     126 132 1.000
594     126 133 1.000
595     127 128 1.000
596     127 129 1.000
597     128 129 1.000
598     128 130 1.000
599     128 131 1.000
600     129 130 1.000
601     129 131 1.000
602     129 132 1.000
603     129 155 1.000
604     129 156 1.000
605     129 157 1.000
606     130 131 1.000
607     130 132 1.000
608     131 132 1.000
609     131 133 1.000
610     132 133 1.000
611     132 134 1.000
612     132 157 1.000
613     132 158 1.000
614     132 159 1.000
615     133 134 1.000
616     133 135 1.000
617     134 135 1.000
618     134 136 1.000
619     134 160 1.000
620     135 136 1.000
621     135 137 1.000
622     136 137 1.000
623     136 138 1.000
624     137 138 1.000
625     137 139 1.000
626     138 139 1.000
627     138 140 1.000
628     138 166 1.000
629     139 140 1.000
630     139 141 1.000
631     139 142 1.000
632     139 163 1.000
633     140 141 1.000
634     140 142 1.000
635     141 142 1.000
636     141 143 1.000
637     142 143 1.000
638     142 144 1.000
639     142 146 1.000
640     142 148 1.000
641     143 144 1.000
642     143 145 1.000
643     143 146 1.000
644     144 145 1.000
645     144 146 1.000
646     145 146 1.000
647     145 147 1.000
648     146 147 1.000
649     146 148 1.000
650     147 148 1.000
651     147 149 1.000
652     148 149 1.000
653     148 150 1.000
654     148 161 1.000
655     148 163 1.000
656     149 150 1.000
657     149 151 1.000
658     150 151 1.000
659     150 152 1.000
660     150 158 1.000
661     150 161 1.000
662     151 152 1.000
663     151 153 1.000
664     152 153 1.000
665     152 154 1.000
666     152 156 1.000
667     152 158 1.000
668     153 154 1.000
669     153 155 1.000
670     154 155 1.000
671     154 156 1.000
672     155 156 1.000
673     155 157 1.000
674     156 157 1.000
675     156 158 1.000
676     157 158 1.000
677     157 159 1.000
678     158 159 1.000
679     158 160 1.000
680     159 160 1.000
681     159 161 1.000
682     160 161 1.000
683     160 162 1.000
684     161 162 1.000
685     161 163 1.000
686     162 163 1.000
687     162 164 1.000
688     163 164 1.000
689     163 165 1.000
690     164 165 1.000
691     164 166 1.000
692     165 166 1.000
693     165 167 1.000
694     166 167 1.000