ViewVC Help
View File | Revision Log | Show Annotations | View Changeset | Root Listing
root/owl/trunk/src/owl/tests/core/structure/data/1od3A_BB_5.0.cm
Revision: 1008
Committed: Wed Mar 31 14:03:27 2010 UTC (12 years, 3 months ago) by hstehr
File size: 7575 byte(s)
Log Message:
refactoring: adapting test packages to match new package structure
Line User Rev File contents
1 duarte 884 #CMVIEW GRAPH FILE ver: 1.0
2     #SEQUENCE: MGSSHHHHHHSSGLVPRGSHMASTPANVNSGPTSPVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSKSGT
3     #PDB: 1od3
4     #PDB CHAIN CODE: A
5     #CHAIN: A
6     #MODEL: 1
7     #CT: BB
8     #CUTOFF: 5.0
9     36 37 1.000
10     36 38 1.000
11     37 38 1.000
12     37 39 1.000
13     38 39 1.000
14     38 40 1.000
15     39 40 1.000
16     39 41 1.000
17     39 84 1.000
18     40 41 1.000
19     40 42 1.000
20     40 84 1.000
21     40 85 1.000
22     40 86 1.000
23     41 42 1.000
24     41 43 1.000
25     41 44 1.000
26     41 86 1.000
27     42 43 1.000
28     42 44 1.000
29     42 85 1.000
30     42 86 1.000
31     42 87 1.000
32     42 162 1.000
33     42 163 1.000
34     43 44 1.000
35     43 45 1.000
36     43 86 1.000
37     43 163 1.000
38     44 45 1.000
39     44 46 1.000
40     44 161 1.000
41     44 162 1.000
42     45 46 1.000
43     45 47 1.000
44     45 161 1.000
45     45 162 1.000
46     46 47 1.000
47     46 48 1.000
48     46 159 1.000
49     46 160 1.000
50     46 161 1.000
51     46 162 1.000
52     47 48 1.000
53     47 49 1.000
54     47 50 1.000
55     47 51 1.000
56     47 159 1.000
57     47 160 1.000
58     48 49 1.000
59     48 50 1.000
60     48 51 1.000
61     48 158 1.000
62     48 159 1.000
63     48 160 1.000
64     49 50 1.000
65     49 51 1.000
66     49 159 1.000
67     50 51 1.000
68     50 52 1.000
69     51 52 1.000
70     51 53 1.000
71     51 81 1.000
72     51 82 1.000
73     52 53 1.000
74     52 54 1.000
75     52 81 1.000
76     52 82 1.000
77     53 54 1.000
78     53 55 1.000
79     53 79 1.000
80     53 80 1.000
81     53 81 1.000
82     54 55 1.000
83     54 56 1.000
84     54 79 1.000
85     54 80 1.000
86     54 81 1.000
87     55 56 1.000
88     55 57 1.000
89     55 77 1.000
90     55 78 1.000
91     55 79 1.000
92     55 80 1.000
93     56 57 1.000
94     56 58 1.000
95     56 59 1.000
96     56 78 1.000
97     56 79 1.000
98     57 58 1.000
99     57 59 1.000
100     58 59 1.000
101     58 60 1.000
102     58 72 1.000
103     58 73 1.000
104     59 60 1.000
105     59 61 1.000
106     59 72 1.000
107     59 73 1.000
108     60 61 1.000
109     60 62 1.000
110     60 70 1.000
111     60 71 1.000
112     60 72 1.000
113     60 73 1.000
114     61 62 1.000
115     61 63 1.000
116     61 70 1.000
117     61 71 1.000
118     62 63 1.000
119     62 64 1.000
120     62 68 1.000
121     62 69 1.000
122     62 70 1.000
123     63 64 1.000
124     63 65 1.000
125     63 68 1.000
126     63 69 1.000
127     64 65 1.000
128     64 66 1.000
129     64 67 1.000
130     64 68 1.000
131     64 69 1.000
132     65 66 1.000
133     65 67 1.000
134     66 67 1.000
135     66 68 1.000
136     67 68 1.000
137     67 69 1.000
138     68 69 1.000
139     68 70 1.000
140     69 70 1.000
141     69 71 1.000
142     69 158 1.000
143     69 159 1.000
144     70 71 1.000
145     70 72 1.000
146     70 158 1.000
147     70 159 1.000
148     71 72 1.000
149     71 73 1.000
150     71 156 1.000
151     71 157 1.000
152     71 158 1.000
153     72 73 1.000
154     72 74 1.000
155     72 156 1.000
156     72 157 1.000
157     73 74 1.000
158     73 75 1.000
159     73 156 1.000
160     74 75 1.000
161     74 76 1.000
162     74 154 1.000
163     74 155 1.000
164     74 156 1.000
165     75 76 1.000
166     75 77 1.000
167     75 78 1.000
168     75 152 1.000
169     75 153 1.000
170     75 154 1.000
171     75 155 1.000
172     76 77 1.000
173     76 78 1.000
174     76 152 1.000
175     76 153 1.000
176     76 154 1.000
177     77 78 1.000
178     77 79 1.000
179     77 152 1.000
180     77 153 1.000
181     78 79 1.000
182     78 80 1.000
183     78 150 1.000
184     78 151 1.000
185     78 152 1.000
186     79 80 1.000
187     79 81 1.000
188     79 150 1.000
189     79 151 1.000
190     79 152 1.000
191     80 81 1.000
192     80 82 1.000
193     80 148 1.000
194     80 149 1.000
195     80 150 1.000
196     81 82 1.000
197     81 83 1.000
198     81 148 1.000
199     81 149 1.000
200     82 83 1.000
201     82 84 1.000
202     82 85 1.000
203     82 146 1.000
204     82 147 1.000
205     82 148 1.000
206     82 149 1.000
207     83 84 1.000
208     83 85 1.000
209     83 146 1.000
210     83 147 1.000
211     84 85 1.000
212     84 86 1.000
213     84 146 1.000
214     84 147 1.000
215     85 86 1.000
216     85 87 1.000
217     85 144 1.000
218     85 145 1.000
219     85 146 1.000
220     85 147 1.000
221     86 87 1.000
222     86 88 1.000
223     86 144 1.000
224     86 145 1.000
225     87 88 1.000
226     87 89 1.000
227     87 90 1.000
228     87 91 1.000
229     87 142 1.000
230     87 143 1.000
231     87 144 1.000
232     87 145 1.000
233     88 89 1.000
234     88 90 1.000
235     88 143 1.000
236     88 144 1.000
237     89 90 1.000
238     89 91 1.000
239     89 142 1.000
240     89 143 1.000
241     89 144 1.000
242     90 91 1.000
243     90 92 1.000
244     90 142 1.000
245     90 143 1.000
246     90 165 1.000
247     91 92 1.000
248     91 93 1.000
249     91 139 1.000
250     91 140 1.000
251     91 141 1.000
252     91 142 1.000
253     91 164 1.000
254     91 165 1.000
255     92 93 1.000
256     92 94 1.000
257     92 137 1.000
258     92 138 1.000
259     92 139 1.000
260     92 140 1.000
261     92 141 1.000
262     92 164 1.000
263     92 165 1.000
264     92 166 1.000
265     93 94 1.000
266     93 95 1.000
267     93 137 1.000
268     93 138 1.000
269     93 139 1.000
270     93 162 1.000
271     93 163 1.000
272     93 164 1.000
273     93 166 1.000
274     94 95 1.000
275     94 96 1.000
276     94 135 1.000
277     94 136 1.000
278     94 137 1.000
279     94 162 1.000
280     94 163 1.000
281     94 164 1.000
282     95 96 1.000
283     95 97 1.000
284     95 135 1.000
285     95 136 1.000
286     95 160 1.000
287     95 161 1.000
288     95 162 1.000
289     96 97 1.000
290     96 98 1.000
291     96 133 1.000
292     96 134 1.000
293     96 135 1.000
294     96 160 1.000
295     96 161 1.000
296     97 98 1.000
297     97 99 1.000
298     97 133 1.000
299     97 134 1.000
300     97 157 1.000
301     97 158 1.000
302     97 159 1.000
303     97 160 1.000
304     97 161 1.000
305     98 99 1.000
306     98 100 1.000
307     98 131 1.000
308     98 132 1.000
309     98 133 1.000
310     98 157 1.000
311     98 158 1.000
312     98 159 1.000
313     99 100 1.000
314     99 101 1.000
315     99 128 1.000
316     99 129 1.000
317     99 131 1.000
318     99 132 1.000
319     99 156 1.000
320     99 157 1.000
321     100 101 1.000
322     100 102 1.000
323     100 124 1.000
324     100 125 1.000
325     100 126 1.000
326     100 127 1.000
327     100 128 1.000
328     100 129 1.000
329     100 131 1.000
330     100 155 1.000
331     100 156 1.000
332     101 102 1.000
333     101 103 1.000
334     101 125 1.000
335     101 126 1.000
336     101 127 1.000
337     101 128 1.000
338     101 129 1.000
339     102 103 1.000
340     102 104 1.000
341     102 123 1.000
342     102 124 1.000
343     102 125 1.000
344     102 155 1.000
345     103 104 1.000
346     103 105 1.000
347     103 123 1.000
348     103 124 1.000
349     103 125 1.000
350     104 105 1.000
351     104 106 1.000
352     104 121 1.000
353     104 122 1.000
354     104 123 1.000
355     104 124 1.000
356     105 106 1.000
357     105 107 1.000
358     105 121 1.000
359     105 122 1.000
360     105 123 1.000
361     105 151 1.000
362     105 152 1.000
363     105 153 1.000
364     105 154 1.000
365     106 107 1.000
366     106 108 1.000
367     106 119 1.000
368     106 120 1.000
369     106 121 1.000
370     106 151 1.000
371     106 152 1.000
372     107 108 1.000
373     107 109 1.000
374     107 119 1.000
375     107 120 1.000
376     107 121 1.000
377     107 149 1.000
378     107 150 1.000
379     107 151 1.000
380     108 109 1.000
381     108 110 1.000
382     108 116 1.000
383     108 117 1.000
384     108 118 1.000
385     108 119 1.000
386     108 120 1.000
387     108 149 1.000
388     108 150 1.000
389     109 110 1.000
390     109 111 1.000
391     109 112 1.000
392     109 115 1.000
393     109 116 1.000
394     109 117 1.000
395     109 118 1.000
396     109 147 1.000
397     109 148 1.000
398     109 149 1.000
399     110 111 1.000
400     110 112 1.000
401     110 115 1.000
402     110 116 1.000
403     110 147 1.000
404     111 112 1.000
405     111 113 1.000
406     111 147 1.000
407     111 148 1.000
408     111 149 1.000
409     112 113 1.000
410     112 114 1.000
411     112 115 1.000
412     113 114 1.000
413     113 115 1.000
414     114 115 1.000
415     114 116 1.000
416     115 116 1.000
417     115 117 1.000
418     116 117 1.000
419     116 118 1.000
420     117 118 1.000
421     117 119 1.000
422     118 119 1.000
423     118 120 1.000
424     118 138 1.000
425     118 139 1.000
426     118 140 1.000
427     119 120 1.000
428     119 121 1.000
429     119 138 1.000
430     119 139 1.000
431     120 121 1.000
432     120 122 1.000
433     120 137 1.000
434     120 138 1.000
435     121 122 1.000
436     121 123 1.000
437     122 123 1.000
438     122 124 1.000
439     123 124 1.000
440     123 125 1.000
441     124 125 1.000
442     124 126 1.000
443     125 126 1.000
444     125 127 1.000
445     126 127 1.000
446     126 128 1.000
447     126 131 1.000
448     127 128 1.000
449     127 129 1.000
450     128 129 1.000
451     128 130 1.000
452     128 131 1.000
453     129 130 1.000
454     129 131 1.000
455     130 131 1.000
456     130 132 1.000
457     131 132 1.000
458     131 133 1.000
459     132 133 1.000
460     132 134 1.000
461     133 134 1.000
462     133 135 1.000
463     134 135 1.000
464     134 136 1.000
465     135 136 1.000
466     135 137 1.000
467     136 137 1.000
468     136 138 1.000
469     137 138 1.000
470     137 139 1.000
471     138 139 1.000
472     138 140 1.000
473     139 140 1.000
474     139 141 1.000
475     140 141 1.000
476     140 142 1.000
477     141 142 1.000
478     141 143 1.000
479     142 143 1.000
480     142 144 1.000
481     143 144 1.000
482     143 145 1.000
483     144 145 1.000
484     144 146 1.000
485     145 146 1.000
486     145 147 1.000
487     146 147 1.000
488     146 148 1.000
489     147 148 1.000
490     147 149 1.000
491     148 149 1.000
492     148 150 1.000
493     149 150 1.000
494     149 151 1.000
495     150 151 1.000
496     150 152 1.000
497     151 152 1.000
498     151 153 1.000
499     152 153 1.000
500     152 154 1.000
501     153 154 1.000
502     153 155 1.000
503     154 155 1.000
504     154 156 1.000
505     155 156 1.000
506     155 157 1.000
507     156 157 1.000
508     156 158 1.000
509     157 158 1.000
510     157 159 1.000
511     158 159 1.000
512     158 160 1.000
513     159 160 1.000
514     159 161 1.000
515     160 161 1.000
516     160 162 1.000
517     161 162 1.000
518     161 163 1.000
519     162 163 1.000
520     162 164 1.000
521     163 164 1.000
522     163 165 1.000
523     164 165 1.000
524     164 166 1.000
525     165 166 1.000
526     165 167 1.000
527     166 167 1.000